KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_1169Help
Entry
BCGMEX_1169       CDS       T01727                                 

Definition
(GenBank) Putative acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCGMEX_1169
   00630 Glyoxylate and dicarboxylate metabolism
    BCGMEX_1169
   00640 Propanoate metabolism
    BCGMEX_1169
   00650 Butanoate metabolism
    BCGMEX_1169
  Lipid metabolism
   00071 Fatty acid degradation
    BCGMEX_1169
   00072 Synthesis and degradation of ketone bodies
    BCGMEX_1169
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCGMEX_1169
   00310 Lysine degradation
    BCGMEX_1169
   00380 Tryptophan metabolism
    BCGMEX_1169
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCGMEX_1169
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCGMEX_1169
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCGMEX_1169
Enzymes [BR:mbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCGMEX_1169
Exosome [BR:mbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCGMEX_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1266008..1266250
Genome map
AA seq 80 aa AA seqDB search
MQLGNQNTMRFAGRPQRFRQSAYPLFNPNSAIALGHPFGGSGARLMTTVLHHMPDKGIRY
GLQTMCEGRGQANATIVELL
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggcaatcaaaacactatgagattcgcagggcggcctcagcgttttcgccaa
agcgcttaccccctgttcaaccccaacagcgcgatcgcgcttggccacccattcggcggc
tcgggggcacggttgatgactacagtgctacaccacatgccggacaagggaattcgctac
ggcttacagacgatgtgcgagggccgcggccaagccaatgccaccattgtggagttgctg
tga

DBGET integrated database retrieval system