KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_1622Help
Entry
BCGMEX_1622       CDS       T01727                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCGMEX_1622 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCGMEX_1622 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCGMEX_1622 (trpB)
Enzymes [BR:mbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCGMEX_1622 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1786653..1787885
Genome map
AA seq 410 aa AA seqDB search
MSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKERVSQDFLDDLDR
LQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRV
IAETGAGQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVVAVQTGSKTL
KDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQGQAGRLPDA
VVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAGSPGAFHGSFSYL
LQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMDAFGLLCRMEGII
PAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETAAKWFGLLGND
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgccatcgccgaaccgaccagtcacgatcctgattccggcggccatttcggc
ggccccagtggttggggtggccgctacgttcccgaggcgctgatggcggtgatcgaagag
gtcaccgccgcctaccaaaaggagcgcgtcagccaggactttctggacgacctagacagg
ctgcaggcgaactatgcgggccggccttcgccgctttacgaggcgacccggttgagccag
cacgctgggtcggcgcgaatctttctgaagcgagaagacctgaaccatactggttctcac
aagatcaacaacgtgctcgggcaggcactgctggcgcgcaggatgggcaagacccgggtg
atcgccgagaccggtgccggccagcacggggtcgccacggccaccgcatgcgcattgctc
ggcctggactgtgtcatctacatggggggcatcgacaccgcccgtcaggcgctaaacgtg
gcccggatgcgattgctgggtgccgaagtcgtcgcggttcagacgggctcgaaaacgctc
aaagacgccatcaatgaggcgttccgggattgggttgccaacgccgacaacacctactac
tgctttggtactgcggccggaccgcatccgtttccaaccatggtgcgcgatttccagcga
atcatcggcatggaggcacgtgtgcagatccagggtcaggccggtcggctgcctgacgcc
gtcgtcgcgtgcgttggtggcgggtccaatgccattggtatttttcatgcgtttctcgat
gacccaggcgtacggctggtcggattcgaggcagccggcgacggcgttgagaccggccgg
catgccgcgacattcaccgctggttcgcccggggcatttcacggatcgttctcgtacttg
ctgcaagacgaggacggtcagaccattgaatcccattcaatttccgcgggtctggattat
ccgggggtgggcccggaacatgcgtggctcaaggaggccgggcgtgtcgattatcggccg
atcaccgactccgaggcgatggacgcgtttggcctgctgtgtcgcatggaaggcatcatc
ccggctattgaatccgcgcacgcggtggccggcgccctcaagctaggtgttgagttggga
aggggcgcggtgattgtggtgaacctgtcgggacgtggcgacaaagatgtcgagacggcc
gcgaaatggtttggcttgctgggcaacgactga

DBGET integrated database retrieval system