KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_1623Help
Entry
BCGMEX_1623       CDS       T01727                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCGMEX_1623 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCGMEX_1623 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCGMEX_1623 (trpA)
Enzymes [BR:mbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCGMEX_1623 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1787885..1788697
Genome map
AA seq 270 aa AA seqDB search
MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGV
PYSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAF
ARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFV
YAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGS
ALVTALTEGLPRLRALTGELAAGVRLGMSA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgt
gcaaacaaccgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcg
tcggtggccgcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggtt
ccgtattcggacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctc
cgtggcggggtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggc
gggcgtgcggtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattc
gcgcgggatctggcggcggccggaggactcggcctgatcactcctgacctcattcccgac
gaggcgcaacagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtc
gcgccgtcctcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtc
tacgcggcgtcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcaccc
gaactggtgggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtg
cggtcgcgcgctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttcc
gcattggtgacggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctc
gctgccggggtacgactagggatgtccgcatga

DBGET integrated database retrieval system