KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_1935Help
Entry
BCGMEX_1935       CDS       T01727                                 

Gene name
aceA
Definition
(RefSeq) putative isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCGMEX_1935 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BCGMEX_1935 (aceA)
Enzymes [BR:mbm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BCGMEX_1935 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2140858..2143158
Genome map
AA seq 766 aa AA seqDB search
MAIAETDTEVHTPFEQDFEKDVAATQRYFDSSRFAGIIRLYTARQVVEQRGTIPVDHIVA
REAAGAFYERLRELFAARKSITTFGPYSPGQAVSMKRMGIEAIYLGGWATSAKGSSTEDP
GPDLASYPLSQVPDDAAVLVRALLTADRNQHYLRLQMSERQRAATPAYDFRPFIIADADT
GHGGDPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQL
DIMRVPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDVPSYKSCFLAMVRRFYELGV
KELNGHLLYALGDSEYAAAGGWLERQGIFGLVSDAVNAWREDGQQSIDGIFDQVESRFVA
AWEDDAGLMTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPP
WDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFP
DQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATAL
RQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQH
LVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQ
PIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSK
MKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgccgaaacggacaccgaggtccacacaccgttcgagcaggactttgagaaa
gacgtagccgccactcagcgatacttcgacagctcgcgctttgctgggatcattcggctc
tacaccgcccgccaagtcgtggaacagcgcggcacgatccccgtcgaccacatcgtggcg
cgagaggcggcgggcgccttctacgagcgtctgcgcgaactctttgcagcccgcaagagc
atcacgacgtttggcccctactcgccggggcaggcggtgagcatgaagcggatgggtatc
gaggcgatctacctcggtggttgggctacctcagctaagggctccagcaccgaagatccg
gggcccgacctcgccagctacccgctgagccaggtgcctgacgatgccgcggtgctggtg
cgcgccttgctcaccgcggaccgcaaccaacactatctacgcctgcagatgagcgagcga
cagcgtgcggcgacaccggcttacgacttccgcccgtttatcatcgccgacgccgacacc
ggccacggcggcgatccgcacgtacgcaacctgatccgccgcttcgtcgaggtcggtgtg
ccgggctaccacatcgaggaccaacgacccggcaccaagaagtgcggccaccagggcggc
aaggtcctggtgccgtccgacgaacagatcaagcggctcaacgccgcccgcttccagctc
gacatcatgcgggtgcccggcatcatcgtcgcacgcaccgacgcggaggcggccaacctg
atcgacagtcgcgccgacgagcgtgaccagccgttccttctcggcgcgaccaagctcgac
gtaccgtcctacaagtcctgtttcctggcaatggtgcggcgtttttacgaactgggcgtc
aaggagctcaatggtcatcttctctatgcgcttggcgacagcgagtacgcggcggccggc
ggttggcttgagcgccaaggcattttcggcttggtctccgacgcggtcaacgcgtggcgg
gaggacggccagcagtcgatcgacggcattttcgaccaggtcgagtcgcggttcgtggcg
gcctgggaggacgacgcgggcctgatgacctacggagaggccgtggcggacgtgctcgaa
ttcggtcagagcgagggcgaacccattggcatggctcccgaggagtggcgggcgttcgcc
gcgcgtgcatcgctgcatgccgcccgggcaaaggccaaggagctgggcgccgatccgcca
tgggactgcgagctggccaagaccccggagggctactaccagatccgcggcggcataccg
tatgcgatcgccaaatcgctggccgcggcaccgtttgccgacattctttggatggagacc
aagaccgccgatctcgccgacgctcgacagttcgccgaggcgatccatgccgagttcccc
gaccagatgctggcgtacaacctctcaccatcgttcaactgggacaccaccggcatgacc
gacgaggagatgcggcgcttccccgaggagctcggcaaaatgggcttcgtcttcaacttc
atcacctatggcgggcaccagatcgacggtgtcgcggccgaggaattcgccaccgcgctg
cgccaggacggcatgctggcgctggctcggttgcagcgcaagatgcgcttggtcgaatct
ccctatcgcacaccgcaaacgctagtcggcgggccgcgcagtgacgccgcattggctgcc
tcctccggacgcacggcgaccacgaaggcaatgggcaagggctccacccagcaccagcac
ttggtgcaaactgaggtgccgcgcaagctgctagaggaatggctggccatgtggagcggt
cactaccagctcaaagacaaactgcgcgtacagcttcggccgcagcgggccggctcggag
gtgctcgagctcggcatccacggcgaaagcgatgacaagctcgccaacgtgatattccaa
ccgatccaagatcgccgcggccgcaccatcctgttggtacgcgaccagaacacgttcggt
gcggaactacgccaaaagcggctgatgaccctgatccacctctggctcgtccaccgcttc
aaggcgcaggcggtgcactacgtcacgcccaccgacgacaacctctaccagacctcgaag
atgaagtcgcatggaatcttcaccgaggtcaaccaggaggtgggcgagatcatcgtcgcc
gaggtgaaccacccgcgcatcgccgaactgctgacgcccgatcgggtggcgctgcggaag
ttgatcacgaaggaggcgtag

DBGET integrated database retrieval system