KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_2204Help
Entry
BCGMEX_2204       CDS       T01727                                 

Gene name
asnB
Definition
putative asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mbm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2423006..2424964
Genome map
AA seq 652 aa AA seqDB search
MCGLLAFVAAPAGAAGPEGADAASAIARASHLMRHRGPDESGTWHAVDGASGGVVFGFNR
LSIIDIAHSHQPLRWGPPEAPDRYVLVFNGEIYNYLELRDELRTQHGAVFATDGDGEAIL
AGYHHWGTEVLQRLRGMFAFALWDTVTRELFCARDPFGIKPLFIATGAGGTAVASEKKCL
LDLVELVGFDTEIDHRALQHYTVLQYVPEPETLHRGVRRLESGCFARIRADQLAPVITRY
FVPRFAASPITNDNDQARYDEITAVLEDSVAKHMRADVTVGAFLSGGIDSTAIAALAIRH
NPRLITFTTGFEREGFSEIDVAVASAEAIGARHIAKVVSADEFVAALPEIVWYLDEPVAD
PALVPLFFVAREARKHVKVVLSGEGADELFGGYTIYREPLSLRPFDYLPKPLRRSMGKVS
KPLPEGMRGKSLLHRGSLTLEERYYGNARSFSGAQLREVLPGFRPDWTHTDVTAPVYAES
AGWDPVARMQHIDLFTWLRGDILVKADKITMANSLELRVPFLDPEVFAVASRLPAGAKIT
RTTTKYALRRALEPIVPAHVLHRPKLGFPVPIRHWLRAGELLEWAYATVGSSQAGHLVDI
AAVYRMLDEHRCGSSDHSRRLWTMLIFMLWHAIFVEHSVVPQISEPQYPVQL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactgctggccttcgtcgcggccccggccggtgctgcggggcccgaaggtgcc
gacgctgccagcgccatcgcccgcgcatcgcatttgatgcgccaccgcgggcccgatgaa
tcgggcacctggcacgccgtcgatggcgcctccggaggcgtcgtgttcgggttcaaccga
ctgtccatcatcgacatcgcgcactcgcatcagccgctgcggtgggggccgccggaggct
ccggaccgctacgtgctggtgttcaacggcgagatctacaactacttggagctgcgtgac
gagctgcgcacccagcacggcgctgtgttcgccaccgacggcgacggtgaggcgatcctc
gccggctatcaccactggggcaccgaggtgctgcagcggttgcgcggcatgttcgcattc
gcgctgtgggacaccgtcacccgcgaattgttctgcgcgcgagatccgttcggcatcaag
ccgttgtttatcgccaccggagccggcggcacggcggtggccagtgagaagaaatgcctg
ctggacctcgtcgagttggtggggttcgacaccgagatcgaccatcgggcgttgcagcac
tacaccgtcctgcagtacgtgccggaacccgagacactgcaccgtggggtacgtcggctg
gaatcaggctgcttcgcccggatccgtgccgaccagctcgcgccggtgatcacccgttat
ttcgtgccgcgatttgcggccagtccgatcaccaacgacaacgaccaggcccgctatgac
gagatcacggcagtgcttgaggactcggtggccaagcatatgcgcgccgatgtcaccgtc
ggcgcgtttctgtccgggggtatcgactccacggccatcgcggcgctggccatccggcac
aatccgcggctgatcaccttcaccaccggtttcgagcgcgagggcttctccgagatcgac
gtcgcggtggcttcggcagaggccatcggtgcccgtcacatcgccaaggtggtcagcgcc
gacgagttcgtcgccgccctgcccgagatcgtctggtacctcgacgagccggtcgctgac
ccagcgctggtaccgttgttcttcgtcgcccgcgaggcccgaaagcacgtcaaagtggtg
ttgtcgggcgaaggcgccgacgaactgttcggcggctacacaatctatcgagaaccgctg
tcgttgaggccgtttgactacctgcccaagccactgcgccggtcgatgggaaaagtttcc
aagccactgccggagggcatgcgcggcaagagtctgctgcaccgcggatcgctgacactc
gaagagcgctactacggcaatgcccgcagtttctccggcgcgcagctgcgcgaagtactg
cccgggttccggccggactggacccacacagatgtcacggcgccggtctacgccgaatcg
gccggctgggatccggtggcgcgaatgcagcacatcgacctgttcacctggctgcgcggc
gacattctggtcaaggccgacaagataacgatggccaactccctggagctgcgggtgccg
ttcctggacccggaggttttcgcggtggcctcccggttgccggcgggcgccaagatcacc
cgtaccaccaccaagtacgcgctgcggcgcgcgctggagcctattgtgcccgcacacgtg
ctgcaccggcccaagctcgggttcccggtcccgatccggcattggctgcgtgccggcgag
ctgctggagtgggcgtatgcgacggtgggctcgtcgcaggccggtcacttggttgacatc
gccgccgtgtatcgcatgctcgacgagcaccggtgcggcagcagcgaccacagccgccgg
ctgtggaccatgctgatctttatgctgtggcacgcgatcttcgtcgagcacagcgtggtg
ccccagatcagcgagccgcagtaccccgtccagttgtaa

DBGET integrated database retrieval system