KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_2609cHelp
Entry
BCGMEX_2609c      CDS       T01727                                 

Gene name
ruvA
Definition
holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mbm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2868051..2868641)
Genome map
AA seq 196 aa AA seqDB search
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLY
GFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGA
ERMVLELRDKVGVAATGGALSTNGHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDAT
TSSALRSALSLLGKAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcggtccgcggtgaggtgctcgaggtggcacttgaccatgtggtgatcgag
gccgccggtgtgggctaccgagtgaacgcgacaccggcgacgctggcgacgttgcggcaa
ggcaccgaggcccggctgatcaccgcgatgattgtgcgcgaggactcgatgacgctgtac
gggtttcccgacggggaaacccgcgacctattcctgacgctgctgtcggtctccggcgtt
gggccccggctggcgatggcggcactggccgtgcacgacgctccggcgctacggcaggtg
ctggccgacggcaacgtcgccgccctgacccgggtgcctgggatcggcaagcggggcgcc
gaacgcatggtgttggaactacgcgacaaggttggggtggcagccaccggcggcgcactc
tcgaccaacggccacgcggtgcgcagtcccgtggtcgaggctctggtcggcctgggcttt
gcggccaaacaggccgaggaggccaccgatacggtgctggccgccaaccatgacgcgacg
acatccagcgcgctgcggtctgccttgtcgttgctggggaaggcccgatga

DBGET integrated database retrieval system