KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_2685Help
Entry
BCGMEX_2685       CDS       T01727                                 

Definition
Enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BCGMEX_2685
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCGMEX_2685
   00650 Butanoate metabolism
    BCGMEX_2685
  Lipid metabolism
   00071 Fatty acid degradation
    BCGMEX_2685
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCGMEX_2685
   00310 Lysine degradation
    BCGMEX_2685
   00360 Phenylalanine metabolism
    BCGMEX_2685
   00380 Tryptophan metabolism
    BCGMEX_2685
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCGMEX_2685
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCGMEX_2685
   00281 Geraniol degradation
    BCGMEX_2685
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCGMEX_2685
   00627 Aminobenzoate degradation
    BCGMEX_2685
   00930 Caprolactam degradation
    BCGMEX_2685
Enzymes [BR:mbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCGMEX_2685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2928063..2928893
Genome map
AA seq 276 aa AA seqDB search
MPVTYDDFPSLRCEIHDQPGHEGVLELVLDSPGLNSVGPHMHRDLADIWPVIDRDPAVRV
VLVRGEGKAFSSGGSFDLIAETIGDYQGRLRIMREARDLVLNLVNFDKPVVSAIRGPAVG
AGLVVALLADISVAGRAAKIIDGHTKLGVAAGDHAAICWPLLVGMAKAKYYLLTCEPLSG
EEAERIGLVSICVDDDDVLPTATRLAERLAAGAQNAIRWTKRSLNHWYRMFGPAFETSLG
LEFIGFGGPDVREGLAAHREKRPARFGADPDPGAGS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagttacctacgacgacttccccagcctgcgctgcgaaatccacgaccaacctggt
cacgaaggcgtgctggagctggtgctggactcccccgggctgaactcggtcgggccgcac
atgcaccgcgaccttgccgacatctggccggtgatcgatcgcgacccggccgtgcgcgtg
gtcttggtccgcggtgaaggcaaggccttttcctccggcggcagtttcgacctgatcgcc
gaaaccatcggcgactaccagggccggctgcgcatcatgcgcgaggcccgcgacctggtg
ctcaacctggtcaacttcgacaagccggtggtgtcggcgattcggggcccggccgtcggt
gcgggtctggttgtcgcgctgctcgccgacatttcggtggcgggccgcgccgcgaagatc
atcgatgggcacaccaaactcggggtcgccgcgggggatcacgcggcgatctgctggccc
ctgctggtcggcatggccaaggccaagtactacctgctgacctgcgagccgctgtccggg
gaggaggccgaacgcatcggtctggtctccatctgcgtcgacgacgacgatgtgctcccc
accgcaacacgcctggcggagcggctcgccgctggcgcgcaaaacgccatccgctggacc
aaacgcagcctcaatcactggtatcgcatgttcggtcccgccttcgaaacgtcgctcggg
ctggagttcatcgggttcggtggtcccgacgtccgggaaggcctggccgcgcaccgcgaa
aagcgccccgcgcggttcggcgccgaccccgatcccggcgccggcagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system