KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_2844Help
Entry
BCGMEX_2844       CDS       T01727                                 

Gene name
echA16
Definition
Enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BCGMEX_2844 (echA16)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCGMEX_2844 (echA16)
   00650 Butanoate metabolism
    BCGMEX_2844 (echA16)
  Lipid metabolism
   00071 Fatty acid degradation
    BCGMEX_2844 (echA16)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCGMEX_2844 (echA16)
   00310 Lysine degradation
    BCGMEX_2844 (echA16)
   00360 Phenylalanine metabolism
    BCGMEX_2844 (echA16)
   00380 Tryptophan metabolism
    BCGMEX_2844 (echA16)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCGMEX_2844 (echA16)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCGMEX_2844 (echA16)
   00281 Geraniol degradation
    BCGMEX_2844 (echA16)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCGMEX_2844 (echA16)
   00627 Aminobenzoate degradation
    BCGMEX_2844 (echA16)
   00930 Caprolactam degradation
    BCGMEX_2844 (echA16)
Enzymes [BR:mbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCGMEX_2844 (echA16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3070622..3071371
Genome map
AA seq 249 aa AA seqDB search
MTDDILLIDTDERVRTLTLNRPQSRNALSAALRDRFFAALADAEADDDIDVVILTGADPV
FCAGLDLKELAGQTALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASEHARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSLTGDYLSATDALRAGLVTEVVAHDQLLP
TARRVAASIVGNNQNAVRALLASYHRIDESQTAAGLWLEACAAKQFRTSGDTIAANREAV
LQRGRAQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacatcctgctgatcgacaccgacgaacgggtgcgaaccctcaccctcaac
cggccgcagtcccgcaacgcgctctcggcggcgctacgggatcggtttttcgcggcgttg
gccgacgccgaggccgacgacgacatcgacgtcgtcatcctcaccggcgccgatccggtg
ttctgcgccggactggacctcaaggagctggccgggcagaccgcgctgccggacatctca
ccgcggtggccggccatgaccaagccggtgatcggcgcgatcaacggcgccgcggtcacc
ggcgggctcgaactggcgctgtactgcgacatcctgatcgcctccgagcacgcccgcttc
gccgacacccacgcccgggtgggcctgctgcccacctggggactcagcgtgcgcttgccg
caaaaggtcggcatcggcctggcccggcggatgagcctgaccggcgactacctgtccgcg
accgacgcgttgcgggccggcctggtcaccgaggtggtggcccacgaccagctgctgccc
accgcccgccgggtggcggcgtcgatcgtcggcaacaaccagaacgcggtgcgggcattg
ctggcgtcctaccaccgcatcgacgagtctcagaccgccgccgggctgtggctggaagcc
tgcgcggccaagcaatttcgcactagcggcgataccatcgccgccaaccgcgaagccgtg
ctgcagcgcggccgcgcgcaggtgcgttag

DBGET integrated database retrieval system