KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_2886cHelp
Entry
BCGMEX_2886c      CDS       T01727                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
  KO
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCGMEX_2886c (dxr)
Enzymes [BR:mbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BCGMEX_2886c (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3115067..3116308)
Genome map
AA seq 413 aa AA seqDB search
MTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTLLRQRAQ
TGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTG
ARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGP
FRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVV
VHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLALGWPRRVSGAAAACDFHTASSWEFEP
LDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGIIADVLHAADQ
WAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAGRHASTLERS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaactcgaccgacgggcgcgctgacggccggttgcgggtggtggtgctgggcagt
accggctcgatcggcacccaggcgcttcaggtcatcgccgacaatccggaccgtttcgag
gtagtcgggctggccgctggcggcgcccatctggacacgttgctgcgacaacgtgcgcag
accggggtgaccaatattgccgtcgctgacgagcacgcggcgcagcgggtcggcgacatc
ccctaccacggatccgacgccgccacccggctggtcgagcagaccgaggccgacgtcgtc
ctcaatgcgctggtcggcgcgttgggcctgcgaccgacgttggccgcgctcaagacgggt
gcccggctggcgctggccaacaaggaatcgctggtcgccggtggttcgctggtgctgcgg
gcggcgcggcccggtcagatcgtgccggtcgactccgaacactccgcgctggcccagtgc
ctgcgcggcggcactcccgacgaggtcgccaagctggtgctgacggcctcgggagggccg
tttcggggctggtccgcggccgacctcgagcatgtcacccccgagcaggctggcgcgcat
cctacgtggtcgatgggcccgatgaacacgctgaattcggcgtcgctggtcaacaaggga
cttgaggtcatcgaaacccacctgctgttcggcatcccctacgaccgcatcgatgtcgtg
gtgcacccccagtcgatcatccattcgatggtcaccttcatcgacggttcgacgatcgcc
caggccagtcccccggacatgaagctaccgatttcgttagcgctgggctggccgcgtcgg
gtcagcggcgccgctgctgcctgtgatttccataccgcgtcgagctgggagttcgagccg
ttggacaccgacgtcttccccgcggtcgagttggcccggcaggccggcgtagccggtggc
tgcatgaccgcggtttacaatgcggcgaacgaagaagcagcagcggcgttccttgctggc
cggatcggcttcccggccatcgtcggcatcatcgccgacgtgttgcacgctgccgaccaa
tgggccgtcgaacccgctaccgtggatgacgtactcgacgcgcagcgctgggcccgcgag
cgagcgcagcgcgcggtatctggtatggcttcggtggcgatcgcaagcacggcgaagccg
ggcgcagcgggtcgacacgcatcgacgttagaaaggtcctga

DBGET integrated database retrieval system