KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_3443Help
Entry
BCGMEX_3443       CDS       T01727                                 

Gene name
echA18
Definition
(GenBank) Putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
mbm00071  Fatty acid degradation
mbm00280  Valine, leucine and isoleucine degradation
mbm00281  Geraniol degradation
mbm00310  Lysine degradation
mbm00360  Phenylalanine metabolism
mbm00362  Benzoate degradation
mbm00380  Tryptophan metabolism
mbm00410  beta-Alanine metabolism
mbm00627  Aminobenzoate degradation
mbm00640  Propanoate metabolism
mbm00650  Butanoate metabolism
mbm00903  Limonene and pinene degradation
mbm00930  Caprolactam degradation
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01120  Microbial metabolism in diverse environments
mbm01130  Biosynthesis of antibiotics
mbm01212  Fatty acid metabolism
Module
mbm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCGMEX_3443 (echA18)
   00650 Butanoate metabolism
    BCGMEX_3443 (echA18)
  Lipid metabolism
   00071 Fatty acid degradation
    BCGMEX_3443 (echA18)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCGMEX_3443 (echA18)
   00310 Lysine degradation
    BCGMEX_3443 (echA18)
   00360 Phenylalanine metabolism
    BCGMEX_3443 (echA18)
   00380 Tryptophan metabolism
    BCGMEX_3443 (echA18)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCGMEX_3443 (echA18)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCGMEX_3443 (echA18)
   00281 Geraniol degradation
    BCGMEX_3443 (echA18)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCGMEX_3443 (echA18)
   00627 Aminobenzoate degradation
    BCGMEX_3443 (echA18)
   00930 Caprolactam degradation
    BCGMEX_3443 (echA18)
Enzymes [BR:mbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCGMEX_3443 (echA18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AET20711
Position
3754655..3755545
Genome map
AA seq 296 aa AA seqDB search
MRRRAMTKMDEASNPCGGDIEAEMCQLMREQPPAEGVVDRVALQRHRNVALITLSHPQAQ
NALNLASWRRLKRLLDDLAGESGLRAVVLRGAGDKAFAAGADIKEFPNTRMSAADAAEYN
ESLAVCLRALTTMPIPVIAAVRGLAVGGGCELATACDVCIATDDARFGIPLGKLGVTTGF
TEADTVARLIGPAALKYLLFSGELIGIEEAARWGLVQKVVAPQDLAAATAKLVGQVCRQS
AVTMRAAKVVANMHGRALTGADTDALIRFGVEAYEGADLREGVAAFSQGRPPKFDD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggcgtgcaatgacgaagatggacgaggctagcaatccgtgcggcggggacatc
gaagctgagatgtgccagttgatgcgcgagcaaccacccgccgaaggcgtcgtcgatcgt
gtcgcgctgcaacgccatcgaaacgttgcgttgatcacgctgagccatccgcaggcgcag
aacgcactcaacctggcgagctggcgtcggctgaagcggctgctggacgatctcgccggc
gaatcggggctgcgggcggtggtgctgcggggcgccggtgacaaggcgttcgccgcgggt
gccgacatcaaggagtttccgaacacccgcatgagcgccgcggacgccgcggagtacaac
gagagcctggccgtctgcctgagggcgttgaccacgatgccgatcccagtcatcgcggcg
gtccgggggctcgccgtcggtggcggctgtgagctggcgacggcctgcgatgtgtgcatc
gcgaccgacgacgcgcgcttcggcatcccgctgggcaagctcggcgtcacgacgggcttc
accgaggcggacaccgtcgcgcgcctcatcggtccggcggcgctgaagtatctgttgttc
agcggagaactgatcggcattgaggaagccgcccgctggggattggtgcaaaaggtcgtc
gcaccacaggatttggcggccgcgacggccaaactggtcggccaggtctgtcggcaatcc
gcggtgaccatgcgtgcggcgaaggtggtcgccaacatgcacggccgagcgctgaccggc
gccgacaccgatgcgctgatccggttcggtgtcgaagcctacgagggggcggacctacgc
gaaggggtggcggccttcagccagggacgcccacccaaatttgatgattag

DBGET integrated database retrieval system