KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_3477cHelp
Entry
BCGMEX_3477c      CDS       T01727                                 

Gene name
choD
Definition
putative cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:mbm00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3792858..3794594)
Genome map
AA seq 578 aa AA seqDB search
MKPDYDVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFSDEEFAKTSWDLRKFLWAPRL
GCYGIQRIHPLRNVMILAGAGVGGGSLNYANTLYVPPEPFFADQQWSHITDWRGELMPHY
QQAQRMLGVVQNPTFTDADRIVKEVADEMGFGDTWVPTPVGVFFGPDGTKTPGKTVPDPY
FGGAGPARTGCLECGCCMTGCRHGAKNTLVKNYLGLAESAGAQVIPMTTVKGFERRSDGL
WEVRTVRTGSWLRRDRRTFTATQLVLAAGTWGTQHLLFKMRDRGRLPGLSKRLGVLTRTN
SESIVGAATLKVNPDLDLTHGVAITSSIHPTADTHIEPVRYGKGSNAMGLLQTLMTDGSG
PQGTDVPRWRQLLQTASQDPRGTIRMLNPRQWSERTVIALVMQHLDNSITTFTKRGKLGI
RWYSSKQGHGEPNPTWIPIGNQVTRRIAAKIDGVAGGTWGELFNIPLTAHFLGGAVIGDD
PEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSIAAQAERAASLWPNKGETDRRPP
QGEPYRRLAPIQPAHPVVPADAPGALRWLPIDPVSNAG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgacgtcctgattattggatcgggtttcgggggcagcgtcaccgcg
ctgcggctgacggaaaagggctaccgggtcggcgtgctggaggccggccgccggttctcc
gacgaggagttcgccaagacgtcgtgggacctgcgcaagtttctctgggcgccgaggttg
ggctgctatggcattcaacgtatccacccgctgcgcaacgtgatgatcctggccggcgcc
ggggtgggcgggggctccctcaactacgccaacacgttgtacgtgccgccggagccgttc
ttcgccgaccagcagtggtcacacatcaccgactggcgtggcgagctgatgccgcactac
cagcaggcgcagcggatgctcggggtggtgcaaaacccgaccttcaccgacgccgaccgc
atcgtcaaggaggtcgccgacgagatggggtttggcgacacctgggtgccgaccccggtt
ggagtgttcttcggccccgacggcaccaagacgcccggcaagaccgtgcccgatccctac
ttcggcggtgccgggccggcgcgcaccggctgcctggaatgcggctgctgtatgacgggc
tgtcgccacggtgccaagaacaccctggtgaaaaactaccttggcctcgcggaatcagct
ggcgcgcaagtgattccgatgaccacggtgaaggggtttgagcggcggtccgacgggttg
tgggaggtccgcacagtgcgaaccggcagttggctgcgccgggatcggcgcaccttcacc
gcaacgcagctggtgctggccgcgggcacctgggggacccagcatctgctgttcaagatg
cgggataggggtcggctccctggtctctcgaagcgattgggtgtccttacccgcaccaac
tcagaatcgatcgtcggggccgccaccttgaaggtcaatccggacctggacctgacccac
ggcgtggcgatcacgtcgtcgattcacccgacggccgacacccacatcgaacccgtgcgc
tacggcaaaggctccaacgcgatggggctgctgcagaccttgatgaccgacggctccggt
ccgcagggcaccgatgtgccgcgctggaggcagttgctgcagaccgccagtcaggatccg
cgcggcaccatccggatgctcaatccccggcaatggagcgagcgcaccgtgatcgcgctg
gtcatgcagcacctggacaactcgatcaccacgttcaccaagcgcgggaagctgggtatc
cgctggtactcgagcaagcagggacacggcgagccgaaccctacatggatcccgatcggc
aaccaggtcacccgtcgcatcgccgccaaaatcgacggcgtggccggcggcacctggggt
gagctgttcaacatcccgctcaccgcgcactttctcggcggcgcggtgatcggcgacgac
cccgagcacggcgtcatcgacccctatcaccgggtctatggctatccgacgctgtacgtg
gttgacggtgcggcgatctcggcgaacctgggtgtcaacccgtcgctgtccatcgccgct
caagccgagcgggccgcctcgctgtggccgaacaagggcgaaaccgaccggcggccaccg
cagggtgagccctatcgtcggctggcgccgatccaaccggcgcacccggtggtgcctgcc
gacgccccgggcgcgctgcggtggttgccgatcgatccggtcagcaacgcgggctga

DBGET integrated database retrieval system