KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_3725Help
Entry
BCGMEX_3725       CDS       T01727                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
mbm00010  Glycolysis / Gluconeogenesis
mbm00620  Pyruvate metabolism
mbm00640  Propanoate metabolism
mbm00680  Methane metabolism
mbm01100  Metabolic pathways
mbm01110  Biosynthesis of secondary metabolites
mbm01120  Microbial metabolism in diverse environments
mbm01130  Biosynthesis of antibiotics
mbm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCGMEX_3725 (acs)
   00620 Pyruvate metabolism
    BCGMEX_3725 (acs)
   00640 Propanoate metabolism
    BCGMEX_3725 (acs)
  Energy metabolism
   00680 Methane metabolism
    BCGMEX_3725 (acs)
Enzymes [BR:mbm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCGMEX_3725 (acs)
Lipid biosynthesis proteins [BR:mbm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCGMEX_3725 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AET20993
Position
4060270..4062225
Genome map
AA seq 651 aa AA seqDB search
MSESTPEVSSSYPPPAHFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWS
GAPFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAA
NALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAK
LLITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVV
GSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDV
FWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTL
IRMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGS
AMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSML
RGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEV
ESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIAR
PRDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagtccacccccgaagtctcctcgtcatacccgccgccagcgcacttcgccgag
cacgcgaacgcccgcgccgagctttaccgcgaggccgaggaagaccggctggctttttgg
gccaagcaggccaaccgactgtcctggacgacgccgttcaccgaggtgttggactggtcg
ggggcgccgttcgccaagtggttcgtgggcggcgagctcaacgtcgcctacaactgtgtg
gatcgtcacgtcgaggccggccatggagatcgggtcgccatccactgggaaggcgagccg
gtcggcgaccggcgcacgctgacctattccgatctgcttgccgaggtatccaaagccgcg
aacgcgctcaccgacctcggtctggtggccggtgaccgcgtcgccatctacctgccgttg
atccctgaggccgtgatcgccatgctggcctgtgcccggctaggcatcatgcatagcgtt
gttttcggcgggttcaccgctgcggccttgcaggcccggatcgtcgacgcccaagccaag
ctgctgatcaccgcggacgggcagtttcggcgcggcaagccatcgcccctcaaggcggcc
gctgacgaggcccttgcagcgatccccgactgctcggtcgagcacgttctggtggtgcgg
cgcacgggaattgagatggcctggagcgagggccgcgacctgtggtggcaccatgtcgtc
ggctcagcttcaccggcacacaccccggagcctttcgattccgagcacccgctgttcctg
ctgtacacgtcaggcaccaccggcaagcccaaaggcattatgcacaccagcggcggctat
ctcactcagtgttgctacacgatgcgcaccattttcgatgtcaagccggacagcgacgtg
ttctggtgcaccgccgacatcggctgggtcaccggccacacctacggcgtctacggcccg
ctgtgcaacggagtcaccgaggttctctacgagggcacgccggatacccccgaccgacac
cggcatttccagatcatcgaaaaatacggcgtgacaatctattacaccgcccccaccctc
atccggatgtttatgaagtggggccgtgagatccccgacagccacgacctgtccagcctg
cggctgctggggtcggtcggcgaaccgatcaaccccgaggcttggcgttggtaccgcgat
gtcatcggcggcggacgcaccccgctggtagacacctggtggcagaccgagaccggctcc
gcgatgatctccccgctgcccggaatcgctgcggccaaaccgggttcagcgatgacgccg
ctgcccgggatctcggccaagatcgtcgacgatcacggtgatccgttgccaccgcacacc
gagggcgcccagcatgttaccgggtacctcgtcctagaccagccgtggccgtcgatgttg
cgcggcatctggggcgaccccgcgcggtattggcactcttactggtccaaattttccgac
aagggctactacttcgccggggacggcgctcgcatagaccccgacggcgcgatctgggta
ctaggccgcatcgacgacgtgatgaacgtgtccgggcaccggatctcgaccgccgaggtg
gaatcggcgctggtcgctcactctggcgtggccgaggcggcggtggtcggggttaccgac
gagaccacgacccaggccatctgtgcgttcgtcgtgctacgcgccaactacgccccccat
gaccgcacagccgaagagttgcgcaccgaagtggctcgagtgatctcgcccatcgcacgg
ccacgcgacgtccacgtagtgcccgaactacccaagactcgtagcggcaaaatcatgcgt
cgactgctgcgcgacgtcgcggaaaaccgtgagcttggcgacacgtcgacgctgctcgat
cccaccgtattcgacgcgatccgggccgccaagtag

DBGET integrated database retrieval system