KEGG   Mycobacterium bovis BCG Mexico: BCGMEX_3755cHelp
Entry
BCGMEX_3755c      CDS       T01727                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mbm  Mycobacterium bovis BCG Mexico
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BCGMEX_3755c (glpK)
Enzymes [BR:mbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BCGMEX_3755c (glpK)
Exosome [BR:mbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCGMEX_3755c (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4090680..4092236)
Genome map
AA seq 518 aa AA seqDB search
MSDAILGEQLAESSDFIAAIDQGTTSTRCMIFDHHGAEVARHQLEHEQILPRAGWVEHNP
VEIWERTASVLISVLNATNLSPKDIAALGITNQRETTLVWNRHTGRPYYNAIVWQDTRTD
RIASALDRDGRGNLIRRKAGLPPATYFSGGKLQWILENVDGVRAAAENGDALFGTPDTWV
LWNLTGGPRGGGVHVTDVTNASRTMLMDLETLDWDDELLSLFSIPRAMLPEIASSAPSEP
YGVTLATGPVGGEVPITGVLGDQHAAMVGQVCLAPGEAKNTYGTGNFLLLNTGETIVRSN
NGLLTTVCYQFGNAKPVYALEGSIAVTGSAVQWLRDQLGIISGAAQSEALARQVPDNGGM
YFVPAFSGLFAPYWRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMEADSGVR
LQVLKVDGGITGNDLCMQIQADVLGVDVVRPVVAETTALGAAYAAGLAVGFWAAPSDLRA
NWREDKRWTPTWDDDERAAGYAGWRKAVQRTLDWVDVS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgccatcctaggagagcaattggccgagtcctcggatttcatagccgccatc
gaccagggcaccaccagcacccgctgcatgatcttcgatcaccacggtgccgaggtggcc
cgccaccagctcgagcacgagcagatcctgccccgggccggctgggtggagcacaacccg
gtcgagatctgggagcgcaccgcgtcggtgttgatctcggtgctcaacgccaccaaccta
tcgccgaaagatattgccgcgttggggattaccaaccaacgtgagacgacgctggtatgg
aatcggcacaccggacggccctactacaacgcgattgtatggcaggatacccgcaccgac
cgcatcgcgtcggcgctggatcgagacggtcgtggaaacctgatccgccgcaaggcgggc
ctgccgccggcaacttatttctctggcggcaagctgcagtggatcctggaaaatgtcgat
ggagtccgcgcggccgccgagaacggcgacgcattgttcggcacaccggacacctgggtg
ttgtggaatctgaccggcgggccgcggggggggggtgtgcatgtcaccgatgtaaccaac
gccagccggaccatgttgatggatctagagacgctggactgggacgacgagctgttgtcg
ttgttttcgatacctcgggccatgctgcccgagatcgcatcgtcggcgccgtcggagcct
tacggtgtcacgctggcgaccgggcctgtcggcggtgaggtgccgatcaccggagttctc
ggtgatcagcatgcggccatggtcggtcaagtctgtctggccccaggggaggcgaaaaac
acctatgggaccggcaattttctgctgctgaacaccggtgaaacgatcgtgcgatcgaat
aacggcctgctaaccacggtgtgctaccaattcgggaacgctaaacccgtgtacgcgctt
gaaggttcgatcgcggtgaccggctcggcggtgcagtggctacgcgatcagctgggcatc
atcagcggcgccgcacagagtgaggcgctggcccgccaggtccccgacaacggcggcatg
tatttcgtgccggcgttttccgggctgttcgcgccatactggcggtccgatgcgcgcggc
gcgatcgtcgggttgtcgcggttcaacaccaacgcgcacctggcgcgcgcaacgctggag
gcgatctgctaccagagccgcgatgtggtggacgccatggaagcagactccggtgttcgc
ctgcaggtgttgaaggtggatggcgggatcaccggcaacgacctgtgtatgcagatccag
gccgacgtgttgggtgtggatgtggtgcggccggtggtcgccgagaccaccgcactaggt
gcggcctacgcggcgggcttggcggtcgggttctgggcggctccgtccgatctgcgggcc
aactggcgagaggacaagcggtggacaccgacgtgggacgacgacgagcgtgccgcgggt
tatgccggctggcgcaaggcggtgcagcggaccctggattgggttgacgtgtcctag

DBGET integrated database retrieval system