KEGG   Methanoregula boonei: Mboo_0172Help
Entry
Mboo_0172         CDS       T00578                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_0172
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_0172
   00020 Citrate cycle (TCA cycle)
    Mboo_0172
   00620 Pyruvate metabolism
    Mboo_0172
   00640 Propanoate metabolism
    Mboo_0172
   00650 Butanoate metabolism
    Mboo_0172
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_0172
   00680 Methane metabolism
    Mboo_0172
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mboo_0172
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mboo_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
170156..170683
Genome map
AA seq 175 aa AA seqDB search
MFEVRIHSRGGQGGVTAAKLLAGAALHDGKYATACPFYGAERRGAPVVSFVRIDDRPIKI
YSQIREPDLVVVLDASVMETVDVLHGLKTGGRVFVNSAHPREFAGYRAAHADLTGIALKE
SLVVAGSPILNTPVIGALAKAGIVSPGSATAAIREMFSDERNVRAAEAAYREMSA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaggtccggatccattcacggggcgggcagggaggagtgaccgcggcaaaactg
ttggccggtgccgcgcttcatgacgggaagtacgcaaccgcctgcccgttctatggcgcc
gagcgccggggagcaccggtggtctcgtttgtccggatcgacgaccgtccgatcaaaatt
tacagccagatccgggagccggaccttgttgttgtcctcgatgcgagcgtgatggagacg
gtcgatgtcctgcacgggttaaagaccggtggcagggtctttgtcaacagcgcccaccca
cgggaatttgccggttaccgtgcggcccatgccgatctcaccggtattgcactcaaagag
agccttgtagtcgcggggagcccgatcctcaacaccccggtgattggggcacttgcaaaa
gccggtatcgtgtcgccgggctcggccacagcggcgatacgggagatgttttccgatgaa
aggaatgtgcgtgcggccgaggccgcgtaccgggagatgagcgcatga

DBGET integrated database retrieval system