KEGG   Methanoregula boonei: Mboo_0173Help
Entry
Mboo_0173         CDS       T00578                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_0173
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_0173
   00020 Citrate cycle (TCA cycle)
    Mboo_0173
   00620 Pyruvate metabolism
    Mboo_0173
   00640 Propanoate metabolism
    Mboo_0173
   00650 Butanoate metabolism
    Mboo_0173
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_0173
   00680 Methane metabolism
    Mboo_0173
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mboo_0173
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mboo_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
170680..170937
Genome map
AA seq 85 aa AA seqDB search
MSPYRNEHVAISRPVAGSAGHTGAWRVFKPVVNRENCNGCGICALYCPDAVIGEDLVIDL
AFCKGCGICANECPKKAIAMVREEK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgtaccggaatgaacatgttgccatcagcaggccggtggccgggtctgccggc
cataccggggcatggcgggtcttcaagccggttgtcaatagggagaactgcaacggatgc
gggatctgtgcgctctattgcccggatgccgttatcggggaggatctcgtcatcgatctt
gcgttctgcaagggctgcgggatctgtgcaaacgagtgcccaaaaaaagcgatcgcgatg
gtccgggaagagaagtaa

DBGET integrated database retrieval system