KEGG   Methanoregula boonei: Mboo_0223Help
Entry
Mboo_0223         CDS       T00578                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mbn  Methanoregula boonei
Pathway
mbn00260  Glycine, serine and threonine metabolism
mbn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01130  Biosynthesis of antibiotics
mbn01230  Biosynthesis of amino acids
Module
mbn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mboo_0223
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mboo_0223
Enzymes [BR:mbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mboo_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABS54745
JGI: mboo0223
UniProt: A7I4T4
Position
complement(210826..211992)
Genome map
AA seq 388 aa AA seqDB search
MGRKGRFGKYGGQYVPETLMNALIELECAYRDATHDPAFAQELAAYQSEYAGRPTPLTFC
GNISRDLGFKVYLKREDLVHGGSHKLNNTLGQALLAKRMRKKRLIAETGAGQHGVATAIA
GAALGFKVEVFMGEVDTKRQALNVFRMELMGATVHPVTCGTKTLKDATNEALRDWVANVN
DTHYLIGSVVGPHPFPTIVRDFQSVIGREARQQVMRKEGKMPDAIVACVGGGSNAIGIFH
PFLADDVELIGIEAAGKGLDTPEHSATLCAGDPGVLHGTLSYLLQDNNGQVLPTHSVAAG
LDYPGVGPEHAMLKDSHRVAYYAVKDHEVLDAFRYLSRTEGIIPALESSHAVAYVLQNCD
RFDKGDVVIINLSGRGDKDVAGIVPEAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtaaaggacgattcggaaaatacggcgggcagtacgtgccggaaaccctgatg
aacgcacttatcgagcttgaatgcgcataccgggacgcgacgcacgatccggcatttgca
caggaacttgcagcataccagtcagaatacgccgggcgccccacaccgcttacgttctgt
gggaacatctcccgggacctcggctttaaggtgtatctcaaacgggaggatctggtccat
ggcggttctcacaagctcaacaacacgctgggccaagcgcttcttgccaaacggatgaga
aagaaacggctgattgcggaaaccggcgccggccagcacggggtcgcaaccgcaattgcc
ggggccgcgctcggctttaaggtcgaggtcttcatgggcgaggtggatacaaaacgccag
gccctcaacgtcttccggatggaattgatgggagcaacggtccacccggtaacctgcggg
acaaagacgctcaaggacgcgacaaacgaagcgctccgtgactgggtcgcaaacgtaaac
gacacgcattatctgatcggatcggtggtcggaccgcacccgttcccgacaattgtccgc
gacttccagtccgtgatcgggcgcgaggcccgccaacaggtcatgcgaaaggagggaaag
atgccggacgcgattgttgcctgcgtgggtggcggctcaaatgcgatcggcatcttccac
cccttccttgccgatgatgtagagctcatcggcatcgaagcggccggcaaaggcctcgat
accccggaacactccgcaacgctctgtgcgggagatcccggcgtgctccacggcacgctc
tcgtacctgcttcaggacaacaacggccaggtgcttcctacgcacagcgtggcggcaggt
ctcgattacccgggtgtcggccccgagcacgcgatgctcaaagattcgcaccgggttgca
tactacgcggtaaaagaccacgaagtgcttgacgccttccggtacctttcgcggaccgaa
gggatcatcccggcgctcgaatcctcacacgcggtggcgtacgtgctgcagaactgtgac
cggttcgataagggcgatgtggtgatcatcaatctttcaggccggggcgacaaggatgtc
gcaggcattgtaccggaggcggcatga

DBGET integrated database retrieval system