KEGG   Methanoregula boonei: Mboo_0327Help
Entry
Mboo_0327         CDS       T00578                                 

Definition
PAS/PAC sensor protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mbn  Methanoregula boonei
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mbn02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mbn02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
314795..317821
Genome map
AA seq 1008 aa AA seqDB search
MMTKPKPKSGPVKKNVPERKSSPDNGAVPEKGEALFPIVGIGASAGGLEAFELFFKTMPA
DSGMAFVLIPHLDPGHASMLSEILQRNTTMPVHEAEDQTSIRPDHVYIIPPNKDMAIFHG
VLQLSTPEQVRGMRLPIDSFFRSLAEDQGERAICVILSGSGSDGTLGLRAVHGAGGVSFV
QDPSTAKYDGMPTSASQSGLATYILPVEKITGQLVSYVKNLAQTGVHPVPMASKAVNATR
RILMLMRSKTGNDFSQYKQSTIQRRIERRMVVHNLSDMDTYARYLQENPAEVAILFKELL
INVTSFFRDKEAFEALETEALPLLFEEKPENYIFRIWVPGCASGEEAYSLAMLFKEKIDE
FRQDFRVQIYATDIDDDAIATARAGMYPSNISLDVSPERLRRFFTKEETGFRIKKEIREM
VVFAVQNVIKDPPFTKMNLISCRNLLIYFESELQARVIPAFHYALSTGGILFLSPSEGIG
NFTDLFSPVNKKWKIYRAKPSGLSARALVAQRFAWTTEPSKKEPGEVFLPSDKTNFAELT
RRVLLASFAPPSVITDENGSIIYVHGDTGKYLQPAPGQISTSVIDMAREGLQLDVRSAIQ
KASAKKTTVVVKGLRVRTNDGIRGVDLTVRPLTDLEPARELLLISFEETKQPPAKKRRSG
KSSGTGEQGSQRIEQLEQDLAYTKENLQATIEEMQAANEELKSSNEELQSTNEELQSTNE
ELETSKEELQSVNEEIVTVNAELQAKIEQLTAVQNDMKNLLENVNIGTIFLDTSLAIRRF
TREAKRVFRLAAADTGRPLADIRSNIPDTDLIADAQGVLDSLIPREKPVRTAGGEWFLVR
IMPYRTLENVIDGVVMTFSDISALKAVEAEARAACDYAQNIVDTIREPLVVLDSAFEVVS
ASGAFYRTFGVTPEKTLGKSLFALGNRQWDIPELHELLETVLPKSTTFENFEVRHDFPGI
GQRVMVLNGRKVIDDTGSIHHILLVMEDITPQRRGADKKPVRGSRGRA
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaaaccaaaaccaaaatccggcccggtaaaaaagaatgtaccggagagaaaa
tcctctcctgataatggggcagtcccggaaaagggtgaggcactgttccctattgtcggg
atcggcgcttcggcgggcgggctcgaagcctttgaactctttttcaagaccatgccggcc
gacagcggcatggcgtttgtgctcatcccccacctcgatcccgggcatgcgagcatgctt
tccgagatcctccagcgcaacaccacgatgccggtccatgaagcagaagaccagacgagt
atccggccggaccacgtgtacatcatcccgcccaataaggacatggcgatcttccacggg
gtgctccagctcagcactcccgaacaggtccgggggatgcggctcccgatcgattcgttt
ttccggtcgcttgccgaggaccagggcgagcgggcgatctgcgtgattctttccggcagc
gggtctgacggcacccttggcctgcgtgcagtccacggggcgggcggggtctcgtttgtg
caggatccttccacggcaaagtacgacggcatgcccacaagcgcgtcccagagcggtctt
gccacctacatcctgccggtggaaaagataaccggacaactggtcagttatgtaaagaac
cttgcccagaccggcgtccacccggttcctatggcgtcaaaagcggtgaatgccacacga
aggatcctgatgctcatgcggtcaaagaccgggaacgatttctcccagtacaagcagagc
acgatccagcgcaggatcgaacggcggatggtggtacataatctcagcgacatggacacg
tatgcacgctacctccaggaaaatcctgccgaggtcgccatcctctttaaggagctgctc
atcaacgtgaccagctttttcagggacaaggaagcgttcgaagcgctggaaacagaagcc
ctgcccctgctttttgaggaaaaaccggagaactatatcttccggatctgggtgccgggg
tgcgcttcgggcgaagaagcttattcgcttgccatgctttttaaggagaagatagatgaa
ttccggcaggatttcagggtccagatctatgcaaccgatatcgatgacgatgcgatcgca
acagcccgggcggggatgtacccgtccaacatctcccttgatgtctcccccgaacggctc
cggcggtttttcactaaagaggagaccgggttccggatcaaaaaagagatccgggagatg
gtggtctttgccgtccagaacgtaataaaagacccgccgtttaccaagatgaaccttatt
tcctgccggaacctgctgatttattttgaaagcgagctccaggcccgggtgatcccggcc
ttccattacgcgctcagcaccggggggatactctttttgagcccctcggaagggatcggg
aattttaccgatctctttagtcccgtcaacaagaagtggaagatctaccgggccaaaccc
tcgggtctgtccgcccgggcgcttgtggcccagcgctttgcatggaccaccgaaccgtca
aaaaaggaaccgggcgaggttttcctcccctccgacaagacaaattttgccgaactcacc
cggcgcgtgctccttgcgtcctttgccccgccgtcggtcataaccgatgagaacgggagc
atcatctatgtgcacggggacaccggcaagtatctccagccggcaccgggacagatcagc
accagtgtcatcgacatggcccgcgagggactgcagttggatgtgaggagtgcgatccag
aaagcatctgcaaagaagactacggttgtcgtaaaaggcctgcgagtcaggacgaacgac
ggtatcaggggagtggacctcacggtacgcccgcttaccgaccttgagccggcacgggaa
ctgctgctcatcagttttgaagagacaaagcagcctcccgcaaaaaaacgccggtcgggc
aaatcctccgggaccggggagcagggatcgcagcgcatcgagcagctggagcaggacctt
gcctatacaaaagaaaacctgcaggccactatcgaggagatgcaggcagcaaacgaggaa
ctcaagtcctcaaacgaggaactccagtctacaaacgaagaactccagtccacaaacgag
gagctggaaacctcaaaggaagaactccagtcggttaacgaagagatcgtgacggttaac
gcagagctgcaggcaaagatcgagcagctcacggcagtccagaacgatatgaaaaacctt
ctcgaaaacgtcaacatcggtactatcttccttgacacaagccttgccatcaggaggttc
acccgcgaggcaaagcgggtattccggcttgctgccgccgatacgggaaggccgcttgcg
gatatccggtcgaacatcccggatacggaccttattgccgatgcacaaggagtacttgac
tcgctcataccccgggaaaaaccggttcgcacggcaggtggcgagtggttccttgtccgc
attatgccgtaccgcacgctggagaacgtaatcgacggcgtagtaatgacgttttccgat
atctccgcgttaaaagcagtggaagccgaggcccgggcagcctgcgactatgcacagaac
attgtcgatacgatccgggagccgctcgtggtcctggattctgcctttgaagtggtttcg
gcaagcggggcattttaccggacctttggcgtgacaccggaaaagaccctggggaaatcc
ctttttgcgcttggcaaccggcaatgggatataccggaactccacgagctgctggagaca
gtcctgccaaagagtacgacctttgaaaatttcgaagtccggcatgatttccccggtatc
gggcagcgggtcatggtcttaaatggccgaaaggttattgacgacacggggagtattcac
catatcctgcttgtaatggaagatattactccccaaagaaggggagcggataaaaaacct
gtccgggggagccggggaagggcctga

DBGET integrated database retrieval system