KEGG   Methanoregula boonei: Mboo_0523Help
Entry
Mboo_0523         CDS       T00578                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mbn  Methanoregula boonei
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mboo_0523
Enzymes [BR:mbn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mboo_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
506606..508132
Genome map
AA seq 508 aa AA seqDB search
MKYSVRILDIATRSGILLNYLDARNIGVLDGDRVQLINPKNSLAVTAVVTTTSTLEGQGT
AGVYRGTNRRLNLTEGEEIEIREADRPASLDFIKKKMDGGRLTKEETLTIIKDVVNDEIS
AAELTAFITASYINPLDMEEVEHLTRAMVETGERIKFASRPIVDKHSIGGVPGNKISLLV
VPIIAASGLKIPKTSSRAITGAGGTADLMEVLANVEFSAREVQEMTEKVGGTIVWGGATN
IAPADDRIILQEYPFKIDARGQMLASVMAKKYAVGANLVVIDIPVGSHTKVPTVQEGRKL
AREFIELGERLGMKVECALTYGDIPVGYSIGPNLEVREALRVLEGATEPNSFIQKSVSLA
GIALEMSGKAARGTGAQMAQDILSSGKALEKFRQIIEIQGGDPKVKSEDILPGEHQFVVN
APASGYIVEMNNVSLITLARLAGAPHDRGAGILLHAKKGTLIKAGEPLFTIYAEREWRLQ
KAVEEGRHLVPVLVEGMLLDRVPSQSEV
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattccgtaaggattctcgatattgcaacgcggagcgggatactgctcaattac
cttgatgcccgaaacattggtgttctggatggtgaccgggtccagctgatcaacccaaaa
aatagtctggccgttactgcggtcgtgacaacaacctcgacccttgaaggacagggtact
gctggtgtgtaccggggcactaaccgacgcctaaacctcaccgaaggggaggagatcgaa
atacgggaagcagatcggccggcatcgcttgatttcatcaagaaaaaaatggacggtggt
cgccttaccaaggaagaaaccctgacgatcattaaggatgtggtcaacgatgagatctcc
gccgccgagctcactgcgtttattactgcatcctacattaatccgctcgacatggaagaa
gtggaacatctcacccgggctatggtcgaaaccggggaacggataaaatttgcatcacgt
cctattgtcgataagcattctatcggaggggtacctggcaacaagatctcccttcttgtg
gttcccattattgctgccagcgggttaaagatccccaaaaccagctcgcgtgccatcaca
ggcgccggcggaactgccgatcttatggaggtacttgccaatgtggaattctccgcccgc
gaagttcaggaaatgacagaaaaggttgggggaaccattgtctggggcggagccaccaac
atcgccccggcagacgatcgcattatcctccaggaatacccgtttaagatcgatgcccgt
ggtcagatgcttgcaagtgtgatggcaaaaaaatatgccgtcggggcaaacctggtggtc
atcgatatcccggtggggagtcataccaaggttcccacagtacaggagggcagaaaacta
gcccgggaatttatcgaactgggagaacgattgggtatgaaagtcgagtgcgccctgacc
tatggagacattccggtgggctatagtatcggccccaatctcgaggttcgggaagcactc
cgcgttctcgaaggcgcaaccgaaccgaattcgtttatccagaaaagtgtctctcttgcc
ggaatcgcgcttgaaatgtccggaaaagcagcccggggaacaggtgcgcagatggcacag
gatatcctttcctcgggaaaagcactggagaaattccggcagatcatcgagatacaggga
ggagacccgaaagtaaaatcagaggatatactgcccggggagcaccagttcgtggttaat
gccccggcgtcaggctacattgttgagatgaacaatgtgtccctgatcacacttgcgcgt
cttgccggagcccctcatgaccggggagcgggcattctgctccatgcaaagaaaggaacc
cttatcaaagccggcgagcccctgtttacgatctatgccgaacgggagtggcggctccag
aaggccgtagaagaagggcggcatcttgtaccagtgctggtggaaggtatgctgcttgac
cgcgtgccttcccagtctgaagtgtaa

DBGET integrated database retrieval system