KEGG   Methanoregula boonei: Mboo_0672Help
Entry
Mboo_0672         CDS       T00578                                 

Definition
(GenBank) thiamine pyrophosphate enzyme domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00020  Citrate cycle (TCA cycle)
mbn00620  Pyruvate metabolism
mbn00633  Nitrotoluene degradation
mbn00640  Propanoate metabolism
mbn00650  Butanoate metabolism
mbn00680  Methane metabolism
mbn00720  Carbon fixation pathways in prokaryotes
mbn01100  Metabolic pathways
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
Module
mbn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mbn_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_0672
   00020 Citrate cycle (TCA cycle)
    Mboo_0672
   00620 Pyruvate metabolism
    Mboo_0672
   00640 Propanoate metabolism
    Mboo_0672
   00650 Butanoate metabolism
    Mboo_0672
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_0672
   00680 Methane metabolism
    Mboo_0672
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mboo_0672
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mboo_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABS55190
JGI: mboo0672
UniProt: A7I629
Position
complement(640122..641021)
Genome map
AA seq 299 aa AA seqDB search
MADKSCELFDAGHRACGGCGAALAARLMLKAAGPESIVVSSTGCMEVFSTPYPETAWKVP
WIHSLFENASAVASGIESSLKKQGRKEKVIVMAGDGATFDIGMLCISGAFERGHDITYIC
YDNEAYMNTGIQRSGATPYDASTTTSPAGSQSFGNKRPKKDMPAILAAHGSPYVATASIA
YPNDLLQKVEKALNTVGPTYVQIHVPCCTGWGFEGEQTIAIAKLAIETGLWVNYEMVDGK
VTKAKKVVRKPVEEYLKTQKRFRHLFKPKRQDAEIAAIQALADKNAEKYGIDIKIAKKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaaatcctgcgaacttttcgacgccggccaccgggcctgcggaggatgcggg
gcggcacttgccgcacggctcatgctcaaggcggccggaccggagtccattgtcgtctct
tcaacgggctgcatggaagtcttctccacgccgtaccccgagactgcgtggaaggtcccg
tggatacactcgctctttgagaacgcttcggcagttgcctccgggatagagtcctccctc
aagaagcagggcaggaaagagaaagtcatcgtgatggccggcgacggcgcgacctttgat
atcgggatgctctgcatcagcggcgcgttcgaacgcggccacgatatcacctacatctgc
tacgataacgaggcctatatgaacaccggtatccagcggtccggtgcaacgccgtacgat
gcgagtacgaccacgagcccggcaggctcccagtccttcgggaacaagcgcccgaaaaag
gacatgccagcgatccttgcggcccacggttctccctatgtggcaacggcatcgattgcc
tacccaaacgacctgctccagaaagtggaaaaggcgctcaacaccgttggcccgacctat
gtccagatccatgtaccctgctgcaccggctggggattcgaaggcgagcagacgatcgcg
attgcaaaactcgccatcgagaccggcctctgggtgaactacgagatggtggacggaaag
gtgaccaaggcaaagaaagtggtcaggaaacccgtcgaggagtacctcaagacccagaaa
cggttccgccatctcttcaagcccaagaggcaggacgccgagatcgcggcgatccaggcc
ttggccgacaagaatgccgagaagtatggcattgatatcaagatagcgaagaaagagtaa

DBGET integrated database retrieval system