KEGG   Methanoregula boonei: Mboo_0675Help
Entry
Mboo_0675         CDS       T00578                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00020  Citrate cycle (TCA cycle)
mbn00620  Pyruvate metabolism
mbn00633  Nitrotoluene degradation
mbn00640  Propanoate metabolism
mbn00650  Butanoate metabolism
mbn00680  Methane metabolism
mbn00720  Carbon fixation pathways in prokaryotes
mbn01100  Metabolic pathways
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
Module
mbn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mbn_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_0675
   00020 Citrate cycle (TCA cycle)
    Mboo_0675
   00620 Pyruvate metabolism
    Mboo_0675
   00640 Propanoate metabolism
    Mboo_0675
   00650 Butanoate metabolism
    Mboo_0675
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_0675
   00680 Methane metabolism
    Mboo_0675
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mboo_0675
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mboo_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF2194
Motif
Other DBs
NCBI-ProteinID: ABS55193
JGI: mboo0675
UniProt: A7I632
Position
complement(642440..642985)
Genome map
AA seq 181 aa AA seqDB search
MRELRIHGRGGQGSVTAAELIAVAAFEGGVFSQAFPAFGVERRGAPVQAFVRFDDRKIRL
RSQVYEPDYIIVQDSTLIKDVNVFSGVKKGGIVIVNTEKAPDYQVPEGVKLITIDATSIA
LKVIGLPITNTSLMGAFAAATGEIKFDALRNALYHRFPKELAEKNIEAARQAFEHVKGAA
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgagagaacttcgtatccacggcaggggtggccagggatcggtcaccgctgcggaactt
attgctgttgctgcgtttgaagggggcgttttttcgcaggcgttcccggcctttggtgtc
gaacggcgcggtgccccggtgcaggcattcgtacggtttgacgaccgtaagatccggctc
cggagccaggtgtacgaaccggactatatcattgtccaggacagcacgctcatcaaagac
gtgaatgttttttcgggagtaaaaaagggtggcatcgtgattgtcaataccgaaaaggca
ccggattaccaagtgcccgaaggcgttaagctgatcaccatcgatgcgacatccattgcg
ctcaaggtgatcgggcttcccatcaccaatacttccctcatgggagcatttgccgcagca
accggcgagatcaagttcgatgcactcaggaatgcactctaccaccggttcccaaaagag
ctcgcggagaagaatatcgaggcagcgcggcaggcgttcgagcacgtgaagggggcggcg
gcataa

DBGET integrated database retrieval system