KEGG   Methanoregula boonei: Mboo_0683Help
Entry
Mboo_0683         CDS       T00578                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mbn  Methanoregula boonei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mboo_0683
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mboo_0683
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mboo_0683
Enzymes [BR:mbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mboo_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(649425..650630)
Genome map
AA seq 401 aa AA seqDB search
MYHLVCVHCGATYSADEILYNCKKCGHLLAVKYPLDTITVKRSTWDARPLSVWRYKELLP
VHIEPVSLQEGGTPLYHLKRLGEEMGLKHLYAKHEGMNPSGSFKDRGMTVGVSMAIQLKK
KSVACASTGNTSASLAVYAAKAGIPAVVLLPAGHVAVGKIAQALMHGAKVISIRGNFDRA
LEMVHDLCLTHGLYLLNSINPYRLEGQKTIGFEAIDQLGCVPDRIVLPVGNAGNISAVYK
GLLELEALDFINSLPKMTGIQATGASPVVRAIKENLPVVQTEENPETLASAIRIGAPVNA
EKALVAIRKTGGTAESVTDDEILAMQRDLARKEGIGVEPASAASVAGIRKLVEMGAIDRD
EKIVCVVTGHLLKDPETVIKQCEPPIEIDADLPSLLSALHL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtaccatctcgtgtgcgttcactgcggtgccacgtattccgctgacgagatcctctat
aactgtaaaaaatgcggtcacctgctcgcggtaaaatatcctcttgatacaataaccgtg
aagcgttccacctgggacgcccgcccgctctcggtctggcgctacaaggagctcctcccg
gtgcatattgagccggtttccctgcaggaaggaggtacccccctctaccacttaaaacgc
ctcggggaagagatggggctgaagcacctttatgcgaaacacgaagggatgaacccgtcg
ggctcttttaaggatcgcgggatgaccgtgggcgtctccatggcaatccagctcaagaag
aagagcgttgcctgcgcaagcaccgggaatacctcggcaagccttgcagtctatgccgca
aaagccgggatcccggcagtcgtgcttctccctgcgggacacgttgctgtcggaaagatt
gcccaggcactgatgcacggtgcaaaggttatctcgatccggggcaatttcgaccgtgca
ctcgagatggtccacgatctctgcctcacgcatgggctctacctcttaaactcgatcaat
ccctaccggctggagggccaaaagacgatcgggtttgaggcaatcgatcagctgggatgc
gtccccgacaggattgtcctcccggtaggaaacgctggaaatatttccgcggtgtacaaa
gggctgctggaacttgaggcactggactttatcaatagcctgccaaaaatgaccggcatt
caggccaccggtgcaagccctgtcgtcagggcaataaaggagaacctgcccgttgtccag
accgaggagaatcccgagacccttgcctcagcaatccggatcggtgcacctgtaaatgca
gagaaggcgcttgttgcaatccgtaagaccggaggaacagccgaatcggtgactgatgat
gagatccttgcgatgcagcgcgatctcgcacgcaaggaaggaatcggcgtggaacctgca
tctgccgcatcagtggccggcatccgcaagctcgtagagatgggtgcgatcgaccgcgat
gagaagattgtctgtgtggtgaccggtcacctcttaaaagacccggaaacagtgattaaa
caatgcgaacccccaatcgagatcgatgcggacctgccctcgctgctctctgcgttgcac
ttgtga

DBGET integrated database retrieval system