KEGG   Methanoregula boonei: Mboo_0727Help
Entry
Mboo_0727         CDS       T00578                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mbn  Methanoregula boonei
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_0727
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mboo_0727
   00640 Propanoate metabolism
    Mboo_0727
   00660 C5-Branched dibasic acid metabolism
    Mboo_0727
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_0727
Enzymes [BR:mbn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mboo_0727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(694383..695468)
Genome map
AA seq 361 aa AA seqDB search
MKLLEYEAKQLFSEEGIRVPKGILVGKHEEILLHMDAIPAKVAVKAQVDVGGRGKAGGVL
MADRDTVIETARKLFNTTIKGLPVQRILIEERLEIRHEYYVSITIDRTKKQPVILFAETG
GIDIEETAKTDKKAIRSISFCPLLADVPGFLLRELCGDAPVEIQATVNRLYHVFCHKDAL
LAEINPLVTTPAGVYAADAKLIIDDNSLARQGIVLNRDLTEREREAEKHGFSYVELQGNI
GVIGNGAGLTMATLDLIEYYGGRAADFLDVGGGADSERVMHAVRLVSGVPTVKVIVVNLL
GGITRCDEVARGIIASGVPEPVIVRIAGTNAEEGRKLLAEKGYEMLDTMDLVVKKAVEVA
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaactactggaatacgaggcaaagcagctcttttctgaagaagggatcagggtgcca
aaaggcatccttgtgggtaagcacgaggagatccttctccacatggatgccattccggcg
aaggtcgcagtcaaggcacaggtggatgtcggcggcaggggaaaggccgggggcgtcctg
atggccgaccgcgacacggtcatcgagacggcaaggaaactcttcaacaccaccatcaag
ggtctgccggtgcagcggatcctgattgaagagcgcctggagatccggcacgagtactat
gtgagcatcaccatagaccggaccaaaaaacagccggtgatcctttttgcagagaccggc
gggatcgatatcgaggagaccgcgaaaaccgacaaaaaagcgatccgctcgatcagtttc
tgcccgcttcttgccgatgtgccgggatttctcctccgcgagctctgcggcgatgccccg
gttgagatccaggcaacggtgaaccggctgtaccacgtcttctgccacaaagacgccctc
cttgccgagataaacccgctggtgactactcccgccggagtgtacgcggccgatgcaaaa
ctcattatcgatgacaacagcctcgcccgccaggggatcgtgctcaaccgggacctcacc
gaacgggaacgggaggcggagaaacacgggttttcgtacgtggagctccaggggaatatc
ggcgttatcgggaacggcgccggcctgaccatggcaacgctcgacctcatcgaatactat
ggcggacgtgcagcggatttccttgacgttggcgggggagcagacagcgaacgggtaatg
cacgctgtccggctggtgtccggggtacctacggtaaaagtgattgtggtcaacctcctt
ggcgggatcacccgctgcgatgaggtggcccgggggattattgcttcaggggtacctgaa
ccggttattgtgcggattgccgggaccaatgccgaagagggcaggaagctccttgccgag
aaaggctacgagatgctcgataccatggatcttgtcgtgaaaaaagccgtggaggttgca
tcatga

DBGET integrated database retrieval system