KEGG   Methanoregula boonei: Mboo_0855Help
Entry
Mboo_0855         CDS       T00578                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mbn  Methanoregula boonei
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mboo_0855
Enzymes [BR:mbn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mboo_0855
Peptidases [BR:mbn01002]
 Cysteine Peptidases
  Family C44
   Mboo_0855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
831911..832915
Genome map
AA seq 334 aa AA seqDB search
MTSFTCTGWVERDGTRLSPAEIEKVVRADPAGVRTFGGEFFLSWDTCHARDHFGIIPGPG
PKGALVCNGEVLSLIEPDPAPCTLEEAIVTAVRLRSDEGVTALSGGVDSGLVAALAQREC
VAVGMKGSHDLARARRAADLLGLTCTEVEITSPEIETALPKVIAAIPKKDPVNTGIALTM
YFVARWAGEHGYRRILAGQGADELFGGYARYLTSPTLEEDLARDVAGLEFQAARDQAVAA
LFGTYLSMPYLDIRVVRAARAIPACEKVRDGQRKIPLREIAAHHIPQELAGYEKKAMQYG
SGVWGELKKLARKNGYKTSVQDYIDHIGRVEHGH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctttacctgtaccggctgggttgaacgggacggtacccggctttccccggca
gagatcgagaaggtggtgcgggccgatccggcaggggtccggacgttcggcggcgaattc
ttcctctcatgggatacgtgtcatgcacgcgatcattttggcatcatcccgggcccgggc
ccgaagggtgcgcttgtctgcaatggcgaggtgctgagtctgatcgagccggacccggca
ccgtgcacccttgaggaagcgattgtgaccgcggtccggctccgcagcgatgagggtgtt
accgcactctcgggcggcgtggactcgggtcttgtggctgcgcttgcacagcgcgaatgc
gtggctgtcggtatgaagggttcccatgatcttgcccgtgcgcggcgtgcggcagacctt
cttggccttacctgtactgaggttgagatcacttcccctgagatcgagacagccctcccg
aaggtaattgcggctataccaaaaaaagacccggtcaataccggtatcgccctcaccatg
tattttgttgcccggtgggcaggagagcacgggtaccgccgcatccttgccgggcagggg
gcagacgagctcttcggcggctatgcccggtatctcacctctcctacccttgaagaagat
ctcgcacgggatgttgcagggctggaattccaggccgcacgcgaccaggcagttgccgcc
ctgtttgggacatatctctccatgccctacctggatatccgggttgtgcgcgctgcacgc
gccatcccggcctgcgaaaaagtacgggacgggcagcgtaaaatccccctgcgggaaatt
gcagcgcaccacatcccgcaggaactggccggctatgagaagaaagccatgcagtacggg
agcggggtttggggagagctaaagaagcttgcccgtaaaaatggttataaaacgtccgtg
caagattacatagaccacatcggacgggtggaacatggtcactga

DBGET integrated database retrieval system