KEGG   Methanoregula boonei: Mboo_0915Help
Entry
Mboo_0915         CDS       T00578                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00620  Pyruvate metabolism
mbn00640  Propanoate metabolism
mbn00680  Methane metabolism
mbn00720  Carbon fixation pathways in prokaryotes
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
Module
mbn_M00357  Methanogenesis, acetate => methane
mbn_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_0915
   00620 Pyruvate metabolism
    Mboo_0915
   00640 Propanoate metabolism
    Mboo_0915
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_0915
   00680 Methane metabolism
    Mboo_0915
Enzymes [BR:mbn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mboo_0915
Lipid biosynthesis proteins [BR:mbn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mboo_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABS55433
JGI: mboo0915
UniProt: A7I6S2
Position
896783..898678
Genome map
AA seq 631 aa AA seqDB search
MDMSADSGQQPKYYTPDPSYRVHSWMGDYSWTYNEFVKDPDKFWDHIAQKLHWFSPYDKV
SEWNYPYAKWFVNGKTNITYNCLDRHVLGDRRNKVALIWKGEYPEEERVFTYRQLYREVQ
RFANGLKKLGVVKGDRVCIYMPVIPEQVIAMLACTRIGAIHSVVFGGYGAAALNQRIVGA
GAKIVITADMAIRRGKAIPLKHIIEEAVINAPTVEKIIILRREQRTPVELHSEMEIDFYE
AMADVSSDCPAEVMDAEDPLFILYTSGTTGAPKGIVHTCGGYMVGVYYTTKYIFDIKEHD
VYWCTADPGWITGHSYVVYGPLSVGATVLIAENTPDYPDPGTWWKIVEEYGVNILYTAPT
AIRMFMKLGEEWPNKYNLSSLRVLGSVGEPLNPEAFEWFYHVIGKDKCPIVDTWWQTETG
MHMVTTVLGEPMRPGFVGKSVPGIVADVVDKDGNSVEPGKSGFLVIKKPWPSMMRTIWNN
DERYRKYWETIPGCYQVGDLAIRGEDGYIMVIGRSDDLIIVSGHNIGTAEVESALVSHKA
VAEAAVIGKPDPLKGNTIKAFVTLRVGHTPSEKLKNELIYHVRITLGPIAMPSEIEFVDS
LPKTRSGKIVRRVLKAKEMGMDPGDISTLDE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggatatgagcgcagattccgggcaacagccgaagtattatacgccggacccctcctac
cgcgtgcacagctggatgggagattattcctggacatacaacgagtttgtcaaggatccg
gacaagttctgggaccacatcgcccagaaactccactggttctccccctacgataaggta
agcgagtggaactacccgtacgcgaagtggtttgtcaacggcaagacaaacatcacgtac
aactgtctggaccggcacgtgctcggggaccggcgcaacaaggtggcgctgatctggaaa
ggcgagtaccccgaggaagagcgtgtctttacctaccggcagctgtaccgtgaggtacag
cggtttgcaaacggtcttaaaaagctgggcgtggtaaagggagaccgggtctgcatttac
atgccggtcatccccgagcaggtgatcgccatgcttgcctgcacacggattggtgccatt
cactccgtggtctttggcgggtacggggccgcagcgctcaaccagcggatcgtgggagca
ggggccaagatcgtgatcactgccgatatggcgatccgtagaggcaaggcgattccgctc
aagcacattatcgaagaggccgttatcaatgccccgactgttgagaagatcattatcctg
cgccgggagcagcgcacgccggtcgagctccacagcgagatggagattgatttctacgag
gcaatggccgatgtcagctccgattgcccggccgaggtcatggatgcggaagacccgctc
tttatcctgtacacgagcggcaccaccggcgcacccaagggaattgtccatacctgcggg
ggctacatggtgggagtgtattatactactaagtacatcttcgacatcaaggagcacgat
gtgtactggtgcaccgccgaccccggctggatcaccggccactcctatgttgtgtacggc
ccgctttcggtgggcgcaaccgtgctcattgccgagaacaccccggattacccggacccg
ggtacatggtggaagatcgtggaggagtacggtgtcaacattctttacactgcgccgacc
gcgatacggatgtttatgaaactcggggaggaatggcccaacaaatataatctcagttcg
ctgcgggtgctcggatcggtcggcgaaccgctcaaccccgaggcattcgagtggttctac
catgtgatcgggaaagacaagtgcccgattgttgatacctggtggcagaccgagaccggc
atgcacatggtgaccacggtgttgggtgagcctatgcggccaggcttcgtgggcaagtct
gtgcccggtatcgtggccgacgttgtggacaaggatggcaacagcgtggagccgggtaag
agtggttttctcgtgatcaaaaagccctggccctccatgatgcggaccatctggaacaac
gacgagcgctaccgcaagtactgggagacaatccccggctgctaccaggtaggagacctg
gccatcagaggcgaggatggttatatcatggtgatcggtcggtccgatgatcttatcatt
gtctcgggccacaatatcggtactgccgaggtggagagtgcacttgtctcccataaggca
gtggcagaagcagcagtgatcggcaaacccgacccccttaagggaaacacgatcaaggcg
tttgttacgctccgcgtcggtcatactccaagcgagaagctcaaaaacgagcttatctac
catgtgcggatcactcttgggcccattgccatgccctcggagatcgagtttgttgactcg
ctgcccaagacccggagcgggaagatcgtccgccgcgttctcaaggcaaaagagatgggg
atggacccgggcgatatatctacgcttgatgaataa

DBGET integrated database retrieval system