KEGG   Methanoregula boonei: Mboo_0915Help
Entry
Mboo_0915         CDS       T00578                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_0915
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_0915
   00620 Pyruvate metabolism
    Mboo_0915
   00640 Propanoate metabolism
    Mboo_0915
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mboo_0915
   00680 Methane metabolism
    Mboo_0915
Enzymes [BR:mbn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mboo_0915
Lipid biosynthesis proteins [BR:mbn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mboo_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
896783..898678
Genome map
AA seq 631 aa AA seqDB search
MDMSADSGQQPKYYTPDPSYRVHSWMGDYSWTYNEFVKDPDKFWDHIAQKLHWFSPYDKV
SEWNYPYAKWFVNGKTNITYNCLDRHVLGDRRNKVALIWKGEYPEEERVFTYRQLYREVQ
RFANGLKKLGVVKGDRVCIYMPVIPEQVIAMLACTRIGAIHSVVFGGYGAAALNQRIVGA
GAKIVITADMAIRRGKAIPLKHIIEEAVINAPTVEKIIILRREQRTPVELHSEMEIDFYE
AMADVSSDCPAEVMDAEDPLFILYTSGTTGAPKGIVHTCGGYMVGVYYTTKYIFDIKEHD
VYWCTADPGWITGHSYVVYGPLSVGATVLIAENTPDYPDPGTWWKIVEEYGVNILYTAPT
AIRMFMKLGEEWPNKYNLSSLRVLGSVGEPLNPEAFEWFYHVIGKDKCPIVDTWWQTETG
MHMVTTVLGEPMRPGFVGKSVPGIVADVVDKDGNSVEPGKSGFLVIKKPWPSMMRTIWNN
DERYRKYWETIPGCYQVGDLAIRGEDGYIMVIGRSDDLIIVSGHNIGTAEVESALVSHKA
VAEAAVIGKPDPLKGNTIKAFVTLRVGHTPSEKLKNELIYHVRITLGPIAMPSEIEFVDS
LPKTRSGKIVRRVLKAKEMGMDPGDISTLDE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggatatgagcgcagattccgggcaacagccgaagtattatacgccggacccctcctac
cgcgtgcacagctggatgggagattattcctggacatacaacgagtttgtcaaggatccg
gacaagttctgggaccacatcgcccagaaactccactggttctccccctacgataaggta
agcgagtggaactacccgtacgcgaagtggtttgtcaacggcaagacaaacatcacgtac
aactgtctggaccggcacgtgctcggggaccggcgcaacaaggtggcgctgatctggaaa
ggcgagtaccccgaggaagagcgtgtctttacctaccggcagctgtaccgtgaggtacag
cggtttgcaaacggtcttaaaaagctgggcgtggtaaagggagaccgggtctgcatttac
atgccggtcatccccgagcaggtgatcgccatgcttgcctgcacacggattggtgccatt
cactccgtggtctttggcgggtacggggccgcagcgctcaaccagcggatcgtgggagca
ggggccaagatcgtgatcactgccgatatggcgatccgtagaggcaaggcgattccgctc
aagcacattatcgaagaggccgttatcaatgccccgactgttgagaagatcattatcctg
cgccgggagcagcgcacgccggtcgagctccacagcgagatggagattgatttctacgag
gcaatggccgatgtcagctccgattgcccggccgaggtcatggatgcggaagacccgctc
tttatcctgtacacgagcggcaccaccggcgcacccaagggaattgtccatacctgcggg
ggctacatggtgggagtgtattatactactaagtacatcttcgacatcaaggagcacgat
gtgtactggtgcaccgccgaccccggctggatcaccggccactcctatgttgtgtacggc
ccgctttcggtgggcgcaaccgtgctcattgccgagaacaccccggattacccggacccg
ggtacatggtggaagatcgtggaggagtacggtgtcaacattctttacactgcgccgacc
gcgatacggatgtttatgaaactcggggaggaatggcccaacaaatataatctcagttcg
ctgcgggtgctcggatcggtcggcgaaccgctcaaccccgaggcattcgagtggttctac
catgtgatcgggaaagacaagtgcccgattgttgatacctggtggcagaccgagaccggc
atgcacatggtgaccacggtgttgggtgagcctatgcggccaggcttcgtgggcaagtct
gtgcccggtatcgtggccgacgttgtggacaaggatggcaacagcgtggagccgggtaag
agtggttttctcgtgatcaaaaagccctggccctccatgatgcggaccatctggaacaac
gacgagcgctaccgcaagtactgggagacaatccccggctgctaccaggtaggagacctg
gccatcagaggcgaggatggttatatcatggtgatcggtcggtccgatgatcttatcatt
gtctcgggccacaatatcggtactgccgaggtggagagtgcacttgtctcccataaggca
gtggcagaagcagcagtgatcggcaaacccgacccccttaagggaaacacgatcaaggcg
tttgttacgctccgcgtcggtcatactccaagcgagaagctcaaaaacgagcttatctac
catgtgcggatcactcttgggcccattgccatgccctcggagatcgagtttgttgactcg
ctgcccaagacccggagcgggaagatcgtccgccgcgttctcaaggcaaaagagatgggg
atggacccgggcgatatatctacgcttgatgaataa

DBGET integrated database retrieval system