KEGG   Methanoregula boonei: Mboo_0915Help
Entry
Mboo_0915         CDS       T00578                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_0915
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_0915
   00620 Pyruvate metabolism
    Mboo_0915
   00640 Propanoate metabolism
    Mboo_0915
  Energy metabolism
   00680 Methane metabolism
    Mboo_0915
Enzymes [BR:mbn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mboo_0915
Lipid biosynthesis proteins [BR:mbn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mboo_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
896783..898678
Genome map
AA seq 631 aa AA seqDB search
MDMSADSGQQPKYYTPDPSYRVHSWMGDYSWTYNEFVKDPDKFWDHIAQKLHWFSPYDKV
SEWNYPYAKWFVNGKTNITYNCLDRHVLGDRRNKVALIWKGEYPEEERVFTYRQLYREVQ
RFANGLKKLGVVKGDRVCIYMPVIPEQVIAMLACTRIGAIHSVVFGGYGAAALNQRIVGA
GAKIVITADMAIRRGKAIPLKHIIEEAVINAPTVEKIIILRREQRTPVELHSEMEIDFYE
AMADVSSDCPAEVMDAEDPLFILYTSGTTGAPKGIVHTCGGYMVGVYYTTKYIFDIKEHD
VYWCTADPGWITGHSYVVYGPLSVGATVLIAENTPDYPDPGTWWKIVEEYGVNILYTAPT
AIRMFMKLGEEWPNKYNLSSLRVLGSVGEPLNPEAFEWFYHVIGKDKCPIVDTWWQTETG
MHMVTTVLGEPMRPGFVGKSVPGIVADVVDKDGNSVEPGKSGFLVIKKPWPSMMRTIWNN
DERYRKYWETIPGCYQVGDLAIRGEDGYIMVIGRSDDLIIVSGHNIGTAEVESALVSHKA
VAEAAVIGKPDPLKGNTIKAFVTLRVGHTPSEKLKNELIYHVRITLGPIAMPSEIEFVDS
LPKTRSGKIVRRVLKAKEMGMDPGDISTLDE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggatatgagcgcagattccgggcaacagccgaagtattatacgccggacccctcctac
cgcgtgcacagctggatgggagattattcctggacatacaacgagtttgtcaaggatccg
gacaagttctgggaccacatcgcccagaaactccactggttctccccctacgataaggta
agcgagtggaactacccgtacgcgaagtggtttgtcaacggcaagacaaacatcacgtac
aactgtctggaccggcacgtgctcggggaccggcgcaacaaggtggcgctgatctggaaa
ggcgagtaccccgaggaagagcgtgtctttacctaccggcagctgtaccgtgaggtacag
cggtttgcaaacggtcttaaaaagctgggcgtggtaaagggagaccgggtctgcatttac
atgccggtcatccccgagcaggtgatcgccatgcttgcctgcacacggattggtgccatt
cactccgtggtctttggcgggtacggggccgcagcgctcaaccagcggatcgtgggagca
ggggccaagatcgtgatcactgccgatatggcgatccgtagaggcaaggcgattccgctc
aagcacattatcgaagaggccgttatcaatgccccgactgttgagaagatcattatcctg
cgccgggagcagcgcacgccggtcgagctccacagcgagatggagattgatttctacgag
gcaatggccgatgtcagctccgattgcccggccgaggtcatggatgcggaagacccgctc
tttatcctgtacacgagcggcaccaccggcgcacccaagggaattgtccatacctgcggg
ggctacatggtgggagtgtattatactactaagtacatcttcgacatcaaggagcacgat
gtgtactggtgcaccgccgaccccggctggatcaccggccactcctatgttgtgtacggc
ccgctttcggtgggcgcaaccgtgctcattgccgagaacaccccggattacccggacccg
ggtacatggtggaagatcgtggaggagtacggtgtcaacattctttacactgcgccgacc
gcgatacggatgtttatgaaactcggggaggaatggcccaacaaatataatctcagttcg
ctgcgggtgctcggatcggtcggcgaaccgctcaaccccgaggcattcgagtggttctac
catgtgatcgggaaagacaagtgcccgattgttgatacctggtggcagaccgagaccggc
atgcacatggtgaccacggtgttgggtgagcctatgcggccaggcttcgtgggcaagtct
gtgcccggtatcgtggccgacgttgtggacaaggatggcaacagcgtggagccgggtaag
agtggttttctcgtgatcaaaaagccctggccctccatgatgcggaccatctggaacaac
gacgagcgctaccgcaagtactgggagacaatccccggctgctaccaggtaggagacctg
gccatcagaggcgaggatggttatatcatggtgatcggtcggtccgatgatcttatcatt
gtctcgggccacaatatcggtactgccgaggtggagagtgcacttgtctcccataaggca
gtggcagaagcagcagtgatcggcaaacccgacccccttaagggaaacacgatcaaggcg
tttgttacgctccgcgtcggtcatactccaagcgagaagctcaaaaacgagcttatctac
catgtgcggatcactcttgggcccattgccatgccctcggagatcgagtttgttgactcg
ctgcccaagacccggagcgggaagatcgtccgccgcgttctcaaggcaaaagagatgggg
atggacccgggcgatatatctacgcttgatgaataa

DBGET integrated database retrieval system