KEGG   Methanoregula boonei: Mboo_1201Help
Entry
Mboo_1201         CDS       T00578                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mbn  Methanoregula boonei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mboo_1201
Enzymes [BR:mbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mboo_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1215556..1216593
Genome map
AA seq 345 aa AA seqDB search
MVKELLRKLSNAHGVSGSEGSVFALIKKELKGCVDEITEDPMGNLIAVRHGNKSKVMLAA
HMDEIGLMVKYIDDKGFLRFITLGGWYGPTLYNQRVIVHGTKGDRIGVIGGKPPHMMDED
ERKKGVKTDDMFIDIGAKNKDDVAELGIEVGTPVTIDREFTELANNRVTGKAFDNRAGVA
MLIKTMQKMKSPFTVYAVFTVQEEVGLKGAKTSAYTIDPDWAIATDVTIPGDHPGIDMKD
AAVEMGKGPVITIVDSSGRGLIASRKVVQWLKNAAETNAIPVQYEVGTGGTTDATSIHLS
RGGVPSTTISPPTRYIHSPVEVLDTGDIEAGVNLLVAALKTKPAL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaattattacggaaattatccaatgcccacggggtatcgggaagtgaaggc
agtgtctttgccttaataaaaaaagaactcaaaggctgtgttgatgagatcaccgaggat
cctatgggaaatctcattgcagtcaggcatggtaacaagtcaaaggtgatgcttgccgcc
catatggacgagatcgggctcatggtcaagtatatcgatgacaagggctttctccggttc
atcactcttggcgggtggtacgggccaacactctataaccagcgcgtgatcgtccatggg
acaaaaggtgaccggatcggtgtcatcggtggcaagcccccgcacatgatggacgaagat
gaacgtaagaaaggggtgaaaaccgacgacatgttcatcgatatcggggcaaaaaacaag
gacgatgttgcggagctgggtattgaggttggcacgccggtaacgattgatcgcgaattt
accgaactcgcgaataaccgcgttaccggtaaggcatttgataaccgggccggtgttgca
atgcttattaagaccatgcagaaaatgaagtccccgttcacggtttacgccgtctttacc
gtgcaggaagaagtgggtctcaaaggggcaaagaccagcgcctatacaatcgatcccgac
tgggccattgctacggatgttaccattcccggcgatcacccggggattgatatgaaggat
gcagcagtagaaatgggaaaagggccggttatcaccattgtcgacagcagcggaagagga
cttattgccagccgcaaggttgtccagtggctgaaaaatgctgctgaaacaaacgcgatt
cccgtgcagtacgaggttggtaccggggggacaaccgatgcaacctctattcacctgtcc
cgcggcggcgtgccaagtaccactatcagcccgcccacacggtacatccactccccggtg
gaagtcctggatacaggggatatagaagccggtgttaacctgcttgttgcagcgctgaag
acaaagcctgcgctttaa

DBGET integrated database retrieval system