KEGG   Methanoregula boonei: Mboo_1201Help
Entry
Mboo_1201         CDS       T00578                                 

Definition
(GenBank) peptidase M42 family protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1215556..1216593
Genome map
AA seq 345 aa AA seqDB search
MVKELLRKLSNAHGVSGSEGSVFALIKKELKGCVDEITEDPMGNLIAVRHGNKSKVMLAA
HMDEIGLMVKYIDDKGFLRFITLGGWYGPTLYNQRVIVHGTKGDRIGVIGGKPPHMMDED
ERKKGVKTDDMFIDIGAKNKDDVAELGIEVGTPVTIDREFTELANNRVTGKAFDNRAGVA
MLIKTMQKMKSPFTVYAVFTVQEEVGLKGAKTSAYTIDPDWAIATDVTIPGDHPGIDMKD
AAVEMGKGPVITIVDSSGRGLIASRKVVQWLKNAAETNAIPVQYEVGTGGTTDATSIHLS
RGGVPSTTISPPTRYIHSPVEVLDTGDIEAGVNLLVAALKTKPAL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaattattacggaaattatccaatgcccacggggtatcgggaagtgaaggc
agtgtctttgccttaataaaaaaagaactcaaaggctgtgttgatgagatcaccgaggat
cctatgggaaatctcattgcagtcaggcatggtaacaagtcaaaggtgatgcttgccgcc
catatggacgagatcgggctcatggtcaagtatatcgatgacaagggctttctccggttc
atcactcttggcgggtggtacgggccaacactctataaccagcgcgtgatcgtccatggg
acaaaaggtgaccggatcggtgtcatcggtggcaagcccccgcacatgatggacgaagat
gaacgtaagaaaggggtgaaaaccgacgacatgttcatcgatatcggggcaaaaaacaag
gacgatgttgcggagctgggtattgaggttggcacgccggtaacgattgatcgcgaattt
accgaactcgcgaataaccgcgttaccggtaaggcatttgataaccgggccggtgttgca
atgcttattaagaccatgcagaaaatgaagtccccgttcacggtttacgccgtctttacc
gtgcaggaagaagtgggtctcaaaggggcaaagaccagcgcctatacaatcgatcccgac
tgggccattgctacggatgttaccattcccggcgatcacccggggattgatatgaaggat
gcagcagtagaaatgggaaaagggccggttatcaccattgtcgacagcagcggaagagga
cttattgccagccgcaaggttgtccagtggctgaaaaatgctgctgaaacaaacgcgatt
cccgtgcagtacgaggttggtaccggggggacaaccgatgcaacctctattcacctgtcc
cgcggcggcgtgccaagtaccactatcagcccgcccacacggtacatccactccccggtg
gaagtcctggatacaggggatatagaagccggtgttaacctgcttgttgcagcgctgaag
acaaagcctgcgctttaa

DBGET integrated database retrieval system