KEGG   Methanoregula boonei: Mboo_1236Help
Entry
Mboo_1236         CDS       T00578                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mbn  Methanoregula boonei
Pathway
mbn00860  Porphyrin and chlorophyll metabolism
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
Module
mbn_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mboo_1236
Enzymes [BR:mbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mboo_1236
Exosome [BR:mbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mboo_1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABS55754
JGI: mboo1236
UniProt: A7I7P3
Position
complement(1254789..1255766)
Genome map
AA seq 325 aa AA seqDB search
MFPTRRMRRVRSRTIQPLLCETTISKNDLVAPLFVDETASAPVPISSMPGQFRYPVSGIA
AVVQKFRDRGIRAVLLFGIPAHKDEGATAAYDPQGVVQQAVRNIKAACPDMLVITDVCAC
EYTSHGHCGIVGDSRCSGPDLLNDESLLLMNKIATSHAEAGADIVAPSCMLDGMVGSIRA
ALDTAGYEEVLILSYSTKFSSALYGPFREAAESGFSFGDRTTYQMNPANGREAFLESQLD
ADEGADILMVKPAGPYLDVLADVATLGLPVAAYQVSGEYSMIKAAAERGWIKEKETVLET
LTCIKRAGADLIITYFAYDVCGWLS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttcccaacgagacgaatgcggcgggtccggtcccgcacgatccagcccctgttgtgc
gagacgaccataagcaaaaacgatcttgtcgccccgctctttgttgatgaaacagcgtct
gccccggtgcccatcagctcgatgcccgggcagttccggtacccggtcagcgggatcgca
gcggtggtacagaaattccgggaccggggtatccgggcggttctcctgtttgggatcccg
gcgcacaaggatgagggtgcaaccgctgcatacgacccgcagggggttgtgcagcaggca
gtacgaaatatcaaggcagcctgccccgacatgctcgtgatcaccgatgtctgcgcctgc
gaatacacaagccacgggcactgcgggatcgtgggggacagccggtgcagcgggccggat
ctccttaatgatgagtcgctcctgcttatgaataaaattgccacaagccatgccgaggcc
ggtgccgatatcgtggccccgtcctgcatgcttgacgggatggtaggatccattcgggcg
gcccttgacacggcagggtacgaagaagtcctgatcctctcgtattccacaaaattttcc
tccgccctgtacggccccttccgcgaggcagcggaatccgggttctcgtttggcgaccgt
accacctaccagatgaacccggccaatggccgcgaggcatttcttgaatcacagctcgat
gccgatgagggcgccgatatcctgatggtcaaaccggccggcccgtacctggatgtgctc
gcagatgtggcaacgctcggcctcccggttgccgcgtaccaggtaagcggggagtattcc
atgataaaagcggcagcggaacgcggctggataaaagagaaggagaccgtgcttgagaca
ctgacctgcatcaagagggccggggccgacctcatcatcacctattttgcgtacgatgtc
tgcgggtggctctcatga

DBGET integrated database retrieval system