KEGG   Methanoregula boonei: Mboo_1283Help
Entry
Mboo_1283         CDS       T00578                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) (EC:1.2.1.12)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:mbn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbn00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1303991..1304962)
Genome map
AA seq 323 aa AA seqDB search
MLRHYAENPPGNIRLTTANSSTSLEDLAYLIKYDSVHGKAPFPVSYGEDYLTLGSHRLDV
VNNRDPARIPWKEHGIDIVLECTGVFTKRIAAAAHITAGASRVIISAPSADADATFVIGV
NERSFDPKKHHIVSNASCTTNSLAPVAKVLNDAFGIESLMMTTVHAYTASQALVDDSART
KRRGRAAAVSLVPSTTGAAEATALTIPALKGKMHAMAIRAPVPDGAITDIVVHVGRHVTV
QEVNDILKMAAENELAGIMEYCEDELVSADIIGNPHSAIIDASSTAVVNGNVVKVMAWYD
NEWGYARRLLDLASYIAGRMEAG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaggcattatgcagaaaacccgccgggtaatatccggcttactaccgctaattcc
tcgacatccctggaggatcttgcgtacctgatcaaatacgattcagttcatggcaaagcc
ccatttccggtgtcgtatggcgaggattacctcacgctcggatcccaccggcttgacgtc
gtgaataaccgtgatccggcccggatcccatggaaggaacacggtatcgatatagtgctc
gaatgcaccggtgtgttcacgaagcggatagcggctgctgcacatatcacagcaggtgct
tccagggttatcatcagcgccccgtcagcggatgctgatgcgaccttcgtaatcggtgtc
aacgagaggtccttcgatccgaaaaaacaccacatagtctcgaatgcatcttgtacgaca
aacagtctcgctcccgtggctaaagtgctcaatgatgcgttcggtatcgaatccctgatg
atgacaaccgttcacgcatataccgcgagtcaggcgctggttgacgactcggcacgaacc
aaacggcggggacgggctgcggcagtatcactggtcccttcgacaaccggtgccgcagag
gcgacggcattgaccatcccggcactgaagggtaaaatgcacgcgatggcaatccgtgct
cccgtcccggatggggcgatcaccgatatcgtagtgcatgtcggacggcacgtcaccgtt
caggaggtcaatgatatcctgaagatggcagccgaaaacgagttggccggcatcatggag
tattgcgaggatgagctggtgtcggccgatatcatcgggaatccgcattccgcaatcatc
gatgcctcatcgaccgctgttgtcaacgggaatgtggtcaaagtgatggcctggtacgac
aacgagtggggctatgcgaggcgactgttggatctcgcgtcatatattgcaggtcgcatg
gaggccggatga

DBGET integrated database retrieval system