KEGG   Methanoregula boonei: Mboo_1450Help
Entry
Mboo_1450         CDS       T00578                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00260  Glycine, serine and threonine metabolism
mbn00680  Methane metabolism
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
mbn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1450
  Energy metabolism
   00680 Methane metabolism
    Mboo_1450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mboo_1450
Enzymes [BR:mbn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mboo_1450
Membrane trafficking [BR:mbn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mboo_1450
Exosome [BR:mbn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mboo_1450
  Exosomal proteins of melanoma cells
   Mboo_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABS55968
JGI: mboo1450
UniProt: A7I8A7
Position
1486331..1487080
Genome map
AA seq 249 aa AA seqDB search
MYTLVLLRHGESTWNKENRFTGWTDVDLSKDGIVEAGRSGRLLNEAGFTFDLCHTSVLRR
AIRTLWIVLDTMDLMYLPVHHSWRLNERHYGALQGLDKRETTEKYGKEQVLLWRRGYAVR
PPALAEEDPRHPRFDPRYAGLGPDALPATESLEDTLARVVPYWKNSIAPEVKAGKRILIA
AHGNSIRALVKYLDHIPDNEITGLNIPTGFPLVYEIDKDLHPIRHYYLGDPDEIRRATES
VADQTSARK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtataccctcgtattgctgcgccatggcgaaagcacctggaacaaagagaaccgcttc
accggctggaccgatgttgacctttcaaaagatgggattgttgaggccgggagatccggc
cggctgcttaacgaagccggcttcacctttgatctctgccatacatctgtgctccgccgg
gctatccggacactctggatcgtacttgacacaatggacctgatgtacctcccggttcat
cattcgtggcggctaaacgagcgtcattacggggcacttcaggggctggacaaacgtgaa
accaccgagaagtacggcaaagaacaggtcctgctctggcgccggggctatgcagtacgc
ccgccggcacttgcagaggaggacccccggcatccccggtttgatccccgctatgcgggt
ctggggccggatgcactaccggcaaccgaatccctggaggatacgcttgcccgggtggtg
ccgtactggaaaaattccattgccccggaggtgaaggcaggaaaacggatccttattgca
gcacacgggaacagtatccgcgcactagtcaagtaccttgatcatattcctgacaatgag
atcaccgggctcaacatcccgaccggtttcccgctggtgtacgagattgacaaggatctg
cacccgatccgtcattactatctgggcgatcccgatgagatccggcgggcaactgagtcg
gtggcagaccagacctcggcaaggaaataa

DBGET integrated database retrieval system