KEGG   Methanoregula boonei: Mboo_1450Help
Entry
Mboo_1450         CDS       T00578                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_1450 (gpmA)
   01230 Biosynthesis of amino acids
    Mboo_1450 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1450 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Mboo_1450 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mboo_1450 (gpmA)
Enzymes [BR:mbn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mboo_1450 (gpmA)
Exosome [BR:mbn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mboo_1450 (gpmA)
  Exosomal proteins of melanoma cells
   Mboo_1450 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1486331..1487080
Genome map
AA seq 249 aa AA seqDB search
MYTLVLLRHGESTWNKENRFTGWTDVDLSKDGIVEAGRSGRLLNEAGFTFDLCHTSVLRR
AIRTLWIVLDTMDLMYLPVHHSWRLNERHYGALQGLDKRETTEKYGKEQVLLWRRGYAVR
PPALAEEDPRHPRFDPRYAGLGPDALPATESLEDTLARVVPYWKNSIAPEVKAGKRILIA
AHGNSIRALVKYLDHIPDNEITGLNIPTGFPLVYEIDKDLHPIRHYYLGDPDEIRRATES
VADQTSARK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtataccctcgtattgctgcgccatggcgaaagcacctggaacaaagagaaccgcttc
accggctggaccgatgttgacctttcaaaagatgggattgttgaggccgggagatccggc
cggctgcttaacgaagccggcttcacctttgatctctgccatacatctgtgctccgccgg
gctatccggacactctggatcgtacttgacacaatggacctgatgtacctcccggttcat
cattcgtggcggctaaacgagcgtcattacggggcacttcaggggctggacaaacgtgaa
accaccgagaagtacggcaaagaacaggtcctgctctggcgccggggctatgcagtacgc
ccgccggcacttgcagaggaggacccccggcatccccggtttgatccccgctatgcgggt
ctggggccggatgcactaccggcaaccgaatccctggaggatacgcttgcccgggtggtg
ccgtactggaaaaattccattgccccggaggtgaaggcaggaaaacggatccttattgca
gcacacgggaacagtatccgcgcactagtcaagtaccttgatcatattcctgacaatgag
atcaccgggctcaacatcccgaccggtttcccgctggtgtacgagattgacaaggatctg
cacccgatccgtcattactatctgggcgatcccgatgagatccggcgggcaactgagtcg
gtggcagaccagacctcggcaaggaaataa

DBGET integrated database retrieval system