KEGG   Methanoregula boonei: Mboo_1525Help
Entry
Mboo_1525         CDS       T00578                                 

Definition
(GenBank) ADP-specific phosphofructokinase/glucokinase
  KO
K00918  ADP-dependent phosphofructokinase/glucokinase [EC:2.7.1.146 2.7.1.147]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00030  Pentose phosphate pathway
mbn00680  Methane metabolism
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1525
   00030 Pentose phosphate pathway
    Mboo_1525
  Energy metabolism
   00680 Methane metabolism
    Mboo_1525
Enzymes [BR:mbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.146  ADP-specific phosphofructokinase
     Mboo_1525
    2.7.1.147  ADP-specific glucokinase
     Mboo_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_PFK_GK
Motif
Other DBs
NCBI-ProteinID: ABS56043
JGI: mboo1525
UniProt: A7I8I2
Position
complement(1592088..1593341)
Genome map
AA seq 417 aa AA seqDB search
MDTGTWSLLYQSVKRPQTGPVLTGFNANIDRIIPVTPGLLRDIHNQPGPGFGALLKRLNH
SMRYCSADEMVMGDPSVFSAISGFFSATGSLVPGGQAGIAAIQVRRLNPATVTCAVPGAG
PQTRAMLQDAGVNPLSFGQESGNNPDRIHLVFEYDPGLVPVARGVVPRSNRFIVSPAHDP
SDVIIPEEQEAAFLEQIAGCRRAFLSGYQFLKTKQEFVTAARQLVQIRSVNPQMRTHVEC
VSGVRPRILGLLLEHILKNTDSIGLNEQELGSFIRILGGPGQNSRADPQSSPVTLVRDAL
SLAHATGVSRLHLHTFGYYILIQKQGTGQPELSRNALLFAAQEAAGAAGGTGSVLSPEGL
RAYADIKTAFGPDESPGIFRAGDLMVLAVPSLIARNVQKTTGLGDIISSTAFVADPF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggataccggtacgtggtctttgttgtaccaatccgtaaaaaggccgcagaccggcccg
gtactgaccggctttaatgccaacatcgaccggatcattccggtcaccccgggtctgctg
cgtgatatccacaaccagcccgggccgggttttggtgcccttcttaaacggctaaaccat
tcgatgcgatactgctctgctgacgagatggttatgggggatccctctgttttttctgcg
atctccggttttttctctgcaaccggttctcttgtgcccgggggacaggcaggaattgca
gcgatccaggtacgcaggctcaatcccgcaacggtgacctgtgccgtacccggcgccggc
ccgcagacaagagcgatgctgcaggacgccggtgtcaatcccctgtcctttggacaggaa
tccggcaataatcccgatcgtatccaccttgtgttcgaatatgatcccggccttgtacct
gttgcccgcggtgtcgtgccccggagcaaccggttcatcgtgtcaccggcccatgacccg
tctgatgtcattatcccggaggaacaggaggctgctttcctcgaacagattgccggctgc
cggcgtgcattcctttccggttaccagttcctgaaaacaaagcaggaatttgtcactgcc
gcacggcagctggtgcagatccgtagcgtcaatccccagatgcggacgcatgttgaatgt
gtctccggggtccggccccggatcctcgggctgctgctcgaacatatcctcaaaaatacc
gacagcatcgggctgaacgaacaggaactgggaagttttatccggattttgggtgggccg
gggcaaaactcccgggcagacccgcagtcctcgccggttacgctggtacgggacgctctt
tcccttgcgcatgccacaggagtatcccggctccaccttcacacgttcgggtactatatc
ctgatccagaaacaggggaccgggcagcctgaattatcccggaatgccctcctctttgca
gcgcaggaggctgccggtgctgcgggagggaccggatcggtcctgtcaccggaaggcctc
cgggcatatgcagacattaagactgcatttggcccggatgaatcaccgggaattttcagg
gccggtgacctgatggtgctggcagttcccagcctcatcgcccgcaatgtccaaaaaacc
accggccttggcgatattatctcctccaccgcctttgttgcagacccgttctaa

DBGET integrated database retrieval system