KEGG   Methanoregula boonei: Mboo_1525Help
Entry
Mboo_1525         CDS       T00578                                 

Definition
(GenBank) ADP-specific phosphofructokinase/glucokinase
  KO
K00918  
ADP-dependent phosphofructokinase/glucokinase [EC:2.7.1.146 2.7.1.147]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1525
   00030 Pentose phosphate pathway
    Mboo_1525
  Energy metabolism
   00680 Methane metabolism
    Mboo_1525
Enzymes [BR:mbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.146  ADP-specific phosphofructokinase
     Mboo_1525
    2.7.1.147  ADP-specific glucokinase
     Mboo_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1592088..1593341)
Genome map
AA seq 417 aa AA seqDB search
MDTGTWSLLYQSVKRPQTGPVLTGFNANIDRIIPVTPGLLRDIHNQPGPGFGALLKRLNH
SMRYCSADEMVMGDPSVFSAISGFFSATGSLVPGGQAGIAAIQVRRLNPATVTCAVPGAG
PQTRAMLQDAGVNPLSFGQESGNNPDRIHLVFEYDPGLVPVARGVVPRSNRFIVSPAHDP
SDVIIPEEQEAAFLEQIAGCRRAFLSGYQFLKTKQEFVTAARQLVQIRSVNPQMRTHVEC
VSGVRPRILGLLLEHILKNTDSIGLNEQELGSFIRILGGPGQNSRADPQSSPVTLVRDAL
SLAHATGVSRLHLHTFGYYILIQKQGTGQPELSRNALLFAAQEAAGAAGGTGSVLSPEGL
RAYADIKTAFGPDESPGIFRAGDLMVLAVPSLIARNVQKTTGLGDIISSTAFVADPF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggataccggtacgtggtctttgttgtaccaatccgtaaaaaggccgcagaccggcccg
gtactgaccggctttaatgccaacatcgaccggatcattccggtcaccccgggtctgctg
cgtgatatccacaaccagcccgggccgggttttggtgcccttcttaaacggctaaaccat
tcgatgcgatactgctctgctgacgagatggttatgggggatccctctgttttttctgcg
atctccggttttttctctgcaaccggttctcttgtgcccgggggacaggcaggaattgca
gcgatccaggtacgcaggctcaatcccgcaacggtgacctgtgccgtacccggcgccggc
ccgcagacaagagcgatgctgcaggacgccggtgtcaatcccctgtcctttggacaggaa
tccggcaataatcccgatcgtatccaccttgtgttcgaatatgatcccggccttgtacct
gttgcccgcggtgtcgtgccccggagcaaccggttcatcgtgtcaccggcccatgacccg
tctgatgtcattatcccggaggaacaggaggctgctttcctcgaacagattgccggctgc
cggcgtgcattcctttccggttaccagttcctgaaaacaaagcaggaatttgtcactgcc
gcacggcagctggtgcagatccgtagcgtcaatccccagatgcggacgcatgttgaatgt
gtctccggggtccggccccggatcctcgggctgctgctcgaacatatcctcaaaaatacc
gacagcatcgggctgaacgaacaggaactgggaagttttatccggattttgggtgggccg
gggcaaaactcccgggcagacccgcagtcctcgccggttacgctggtacgggacgctctt
tcccttgcgcatgccacaggagtatcccggctccaccttcacacgttcgggtactatatc
ctgatccagaaacaggggaccgggcagcctgaattatcccggaatgccctcctctttgca
gcgcaggaggctgccggtgctgcgggagggaccggatcggtcctgtcaccggaaggcctc
cgggcatatgcagacattaagactgcatttggcccggatgaatcaccgggaattttcagg
gccggtgacctgatggtgctggcagttcccagcctcatcgcccgcaatgtccaaaaaacc
accggccttggcgatattatctcctccaccgcctttgttgcagacccgttctaa

DBGET integrated database retrieval system