KEGG   Methanoregula boonei: Mboo_1526Help
Entry
Mboo_1526         CDS       T00578                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  
glycogen phosphorylase [EC:2.4.1.1]
Organism
mbn  Methanoregula boonei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mboo_1526
Enzymes [BR:mbn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Mboo_1526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1593494..1595653
Genome map
AA seq 719 aa AA seqDB search
MADHKDGLADRFPHVPERLSGLVDLAYNLWWSWHPEARVLFKQINQQAWKKSLHNPVKML
RDIPPEYLDGVLANPAYLRRYDIIMNRFSRYMANHSGWFSEHYPKEKSQPIAYFSAEYGL
HHSLPFYAGGLGFLAGDHLKECSDLGVPLVAVGFMYSEGYLHQHIRPDGWQDNITEVLDR
DAAPITRVLNAAGNQMVIQVPFIEPRMYAAAWKVNVGKIPLFLLDTDIAENLPENRTISH
RLYAEQTAQRLKQEIVLGIGGRKMLAELGIGFAAVHLNEGHPAFALLEGIRERVAAGMTF
PDAMEQVKRTSVFTTHTPVPAGNDIFPRDLMNTYFSSYYGQMGIDAETFFGLGHHPCDEG
TGFNMTAFALRLTQYHNAVSKKHGTVARAMWHCMWPGTSEQEVPIDHITNGVHLPTWLNP
RMETLYSDYFRCVDPLWHEDHDNPEIWQMIEEIPDKKLWEMHLWLKQKLFNRIRERKRIK
WGSQLNEPGNLVAEGLMLNPSVLTIGFARRFSSYKRADLIFHDRTRLKRILTNPWRPVQI
IFAGKAHPADNEGKEILQRIYEFAQQPEFGGRIGFVEDYGEQMAQYLVHGVDVWMNNPVP
PMEACGTSGMKASLNGVLNLSILDGWWIEGYQGKNGWAFEGDPSQETRDASDSTALYNLL
EKEVMPLYYSASMDGIPHGWVKMMKESIKSTSAAFSARRMVKEYVTRYYPTLVAGAQDR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcataaggacgggcttgcagacaggttcccacatgtgccggaacggttatcc
ggccttgtcgatctggcatacaatctctggtggagctggcaccccgaggcacgggtgctc
tttaagcagatcaaccagcaggcatggaaaaaaagcctccataacccggtgaagatgctc
cgggatatccctcccgaatatcttgacggcgttcttgccaatcccgcatatcttcgccgt
tatgatatcatcatgaaccgtttttcccggtacatggcaaaccacagcgggtggttttca
gaacattacccaaaagaaaaatcgcagcccattgcctatttctctgcggagtacggcctc
catcactcgctcccgttttatgcaggcggcctcgggttccttgcaggggatcatttaaag
gaatgcagcgatctcggggtcccgctggtcgcagtgggattcatgtactccgaaggttac
ctccaccagcatatccgtcccgatggctggcaggataatatcacggaagtgcttgaccgc
gatgctgcgccgattacccgggtcctgaacgctgccggcaaccagatggtcattcaggtc
ccgttcatcgagccccggatgtatgcagcggcatggaaggtcaacgtgggaaaaattccc
ctcttcctgctcgatacggatattgcagaaaatcttcccgaaaacaggaccatctcccac
cgcctgtacgcagagcagaccgcacagcgcctcaaacaggagatcgttcttgggattggc
ggccggaagatgcttgccgaacttggcataggatttgccgccgtgcaccttaacgaaggt
catccggcatttgcgctgctggaaggaatccgggagcgcgtggcggcaggcatgaccttt
cccgatgccatggagcaggtgaaaagaacctcggtctttaccactcacaccccggtcccc
gccggcaatgatatctttccccgcgatcttatgaatacgtatttctcctcctattatggg
cagatgggtatcgacgctgagaccttttttggcctcgggcaccacccctgtgatgagggg
accgggtttaacatgaccgcgtttgccctcaggctcacgcagtaccacaacgcggtctca
aaaaaacatggtacggttgcccgggcaatgtggcactgcatgtggcccggcacaagcgag
caggaagtccccatcgaccatatcacaaacggggtccatcttcccacgtggctcaacccc
cggatggaaaccctgtactcggattatttcaggtgcgttgatcccctctggcacgaggac
cacgataacccggagatctggcagatgattgaggagatcccggacaagaaactctgggag
atgcacctctggctcaaacagaaactcttcaacaggatccgggagcgcaaaaggataaaa
tggggaagccagctcaatgagcccggcaaccttgtggcagaaggcctgatgctcaacccc
tccgtcctcaccatcggatttgcccgtcgtttttcttcctataaacgggcagatttgatt
tttcatgacaggacacgcctcaagaggatcctgaccaatccctggcgcccggtgcagatt
atttttgccggaaaagctcaccctgcagataacgagggtaaagagatcctccagcggata
tacgaatttgcccagcagccggaatttggcggcaggatcgggtttgtggaagattacggg
gaacagatggcccagtaccttgtccacggcgtggatgtctggatgaacaaccctgtaccc
cccatggaggcgtgcgggacaagcggaatgaaggcttccttaaacggggtactgaacctg
agcatccttgacgggtggtggattgagggctaccagggaaaaaacggatgggcgttcgaa
ggcgatccgtctcaggaaacgcgggacgcatcggactccactgcgctctataatctgctt
gaaaaagaggtaatgccgctttattattctgcatccatggacgggatcccccatggctgg
gtaaagatgatgaaggaatccataaagagcaccagtgcagcattttccgcccgccgtatg
gtcaaggaatatgttaccaggtactatcccaccctcgtggcgggtgcacaggacagatga

DBGET integrated database retrieval system