KEGG   Methanoregula boonei: Mboo_1528Help
Entry
Mboo_1528         CDS       T00578                                 

Definition
(GenBank) response regulator receiver protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg PadR TrmB DUF99 Penicillinase_R TBPIP
Motif
Other DBs
NCBI-ProteinID: ABS56046
JGI: mboo1528
UniProt: A7I8I5
Position
1600023..1601375
Genome map
AA seq 450 aa AA seqDB search
MPKILVVDDEAIITMQLEERLHAMGYTVAGMAASGEDAIGKARRLSPDLILMDIVMPGKL
NGIEAAEVICSELDIPVIFVTSYADDAIIEKAKKARPYGYIVKPFSELEIKAAIEVALFR
KAAERESKQNAEAARAATPLQPATLPGTAPGAVQEAEYLALPEIKTVLLKDIFSGIVLFL
YVDPQVKDPIFKFAIEAGIQKGGRTFFAYHQSVLQKYFLEEGRSGRLFSRRIKPGELFLL
HSLIEKCTQTLPPAGSGGSLQVLFDFSDTGEFDDIVAVKNMILKYRETGVPITGIIAASM
AGLDHERIRLLSEGIAKIIVSTGKDTMISFAHSTFPPESITVVPQATIEDVVKKLLEPVI
LSILEKPISGFDIVHEIHNRYKVLIPQARIYTYLYELQKNGYLEMKVSGKSKLYYPTESG
KKYIRQRLIEFKFVFRHIMGEEPALPVKKE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagattcttgtggtcgacgatgaagcaatcattaccatgcagctcgaagagagg
ctgcatgcaatggggtacacggttgccggcatggcagcatcgggagaggatgcgatcggg
aaggcacgcaggctctcacccgatcttattctgatggacatcgttatgccgggaaaactc
aacggcatcgaggcagcggaggtcatttgttcagaactggacatcccggtgatttttgtt
acctcgtacgccgatgacgcgattattgagaaggcaaaaaaggcccggccgtacggctat
atcgtaaaacccttcagtgaactggaaataaaagcagccattgaagtggccctcttccgc
aaggcagcggaacgggaatcaaaacaaaacgcagaggccgccagggccgcgaccccgctg
cagcctgcgactcttccgggtactgcccccggggcggtacaggaagcggagtaccttgcc
ctgcccgagataaaaacggtgctgttaaaggatatcttctccggcattgtccttttcctc
tatgtggatccccaggtaaaggatccgatattcaaattcgccattgaggcagggatccaa
aaaggggggcggactttctttgcctaccaccagtccgtgctgcagaaatatttccttgaa
gagggccggagcggccggctctttagccggcgtataaaaccaggggaactctttttgctg
cacagtcttatcgaaaaatgcacccagacccttcccccggcaggttccgggggcagtctc
caggtacttttcgacttttccgacaccggggagttcgacgatatcgtagcggtaaaaaac
atgatcctgaaatacagggagaccggtgtccccatcaccggcattattgccgccagcatg
gctggtcttgatcacgaacggatccggctgctctcggaaggcattgcaaagatcatcgtg
tcgaccgggaaggacacgatgatttcctttgcccattcaacgttcccgcccgagtccatc
actgttgtcccccaggccacaatcgaggacgtggtaaagaaactgcttgaaccggtcata
ctctccattctcgaaaaaccgatctccgggtttgatattgtccatgagatccataaccgg
tacaaggttctcatcccccaggcgcggatttatacgtacctctacgaactccagaagaac
gggtacctggagatgaaggtatccggcaaatcaaagttgtactatcctactgagagcggg
aaaaaatacatccggcagcgcctgatcgagttcaaatttgtcttccggcacatcatgggc
gaagagccggctctcccggtaaaaaaggaatga

DBGET integrated database retrieval system