KEGG   Methanoregula boonei: Mboo_1538Help
Entry
Mboo_1538         CDS       T00578                                 

Definition
(GenBank) glycosyl transferase, group 1
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1609691..1610830
Genome map
AA seq 379 aa AA seqDB search
MESLNVAFFCWESLYAERVGGLASAATRLAESLAKDHTVHFFTRGWTKDQEINGVSYHYC
RPQGNNTVQYCEDMSNQMVDQFRQSDRKEKFDILHFHDWHPVQALHRLQDRDTILTFHST
EYGRNGNQYGDWWEYKEISGKEWYGGLIAKKVTAVSSVMKREVMQLYNIPDWKCDVVPNG
IVPQQYRASIDPGDVKRAYGIHPYAPLILFIGRLVYQKGPDLFIEALRKVCHDRWDAKVI
VAGDGGMRQYLQDRARDLPVNFVGYIPDSEYIRLLNACDLVVIPSRNEPFGLVLLEAWSA
EKPVVACDVGGLSENIDTFVNGIKVQPEPDSIAWGIGAMIDDPTTAQVRGRRGRAKVDRQ
FLWSPIARRMADTYSRACG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggagtcacttaacgtagcatttttctgctgggaatcgctttatgccgaacgcgtaggg
gggctcgcgagtgcggcaacacggcttgcagagagccttgcaaaagatcacaccgtgcat
ttctttacccggggatggacaaaagaccaggagatcaatggcgtctcgtatcattactgc
aggccccaggggaacaacaccgtgcagtactgcgaggacatgagcaaccagatggtcgac
cagttccggcagtccgacaggaaagaaaagtttgatatcctgcacttccatgactggcat
cccgtgcaggcgctccaccggcttcaggaccgggataccatccttacattccattccacg
gagtacggcaggaacgggaaccagtacggcgactggtgggagtataaggagatctccggc
aaggaatggtatggcgggcttatcgcaaagaaggtgaccgcggtctcaagtgtcatgaaa
cgggaagtgatgcagctctataatatccctgactggaaatgcgacgtggtgccaaacggt
atcgtgccgcaacagtaccgggccagtatcgatcccggggacgtgaaacgggcatacggg
atccatccctatgcgcccctgatccttttcatcggccgtctcgtataccagaaaggcccg
gacctgtttatcgaggctctgcggaaggtgtgccacgaccgctgggatgcaaaggtgatt
gtggccggggacggcgggatgcggcagtatctccaggaccgggcacgggaccttcccgtc
aattttgtcgggtatatcccggactctgaatacatccggctcctgaatgcctgcgacctc
gtggtcatcccgagcaggaacgagccgttcggccttgtgctgctcgaagcatggagcgcg
gaaaaaccggtggtggcctgtgatgtcggcggcctttccgagaacatcgacacgtttgtc
aacggcatcaaggtgcagccggaaccggattcgattgcatggggaatcggtgcgatgatc
gacgatcccacgacagcgcaggtgcggggacggaggggacgggcaaaagtggaccggcag
ttcctctggagcccgatcgcacgccgtatggcagacacctattcgcgggcatgcgggtga

DBGET integrated database retrieval system