KEGG   Methanoregula boonei: Mboo_1539Help
Entry
Mboo_1539         CDS       T00578                                 

Definition
(GenBank) NADH:flavin oxidoreductase/NADH oxidase
  KO
K10680  
N-ethylmaleimide reductase [EC:1.-.-.-]
Organism
mbn  Methanoregula boonei
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mboo_1539
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     Mboo_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1610907..1611983
Genome map
AA seq 358 aa AA seqDB search
MSLFSPYVLGDLVLANRMIMAPMTRCRAIDCNVPGPLSVIYYVQRAAAGLIITEGSQVSP
QGVGFIRTPGIYSDEQVAGWKKVTSAVHQAGGKMFIQLWHVGRVSHPDFLDGGLPVAPSA
LPVNEVIHTPLGKMMIPIPRALGLTEIPKIVHEFQDAAAYAKEAGFDGVEIHGANGYLLD
QFLRDGSNHRTDRYGGSLANRARLPIEITEAVVAVWGAKKVGYRISPHFNLHAMSDTHPR
ETFGHLADRLSKLGIAYIHLVEPVGGKLGEVSPDAQMAPLIRKKFDGALILNGGYDKESA
TRVIEDGLADLVAFGTLFLANPDLPERFKRGAPLNTEDPATFYTGEEKGYTDYPALGK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagtttattctccccgtacgttttaggtgacctcgtgcttgcaaaccggatgataatg
gcgccgatgacccggtgccgcgccatcgactgcaatgtcccgggtccgctctcggtcata
tactatgtccagcgggcagcggccggtctcatcatcactgaaggttcccaggtcagcccg
cagggcgtggggtttatccggacgcccgggatttattcggatgagcaggttgccggctgg
aagaaggtaacttctgccgtccaccaggccgggggaaagatgtttatccagctctggcac
gtgggccgcgtgtcgcacccggattttctcgacggtggcctcccggttgcgccctctgcc
ctcccggtcaacgaggtgattcacacgcccttgggaaagatgatgatccccatcccacgg
gcgctcgggcttacggagatcccaaagatcgtgcatgagttccaggacgccgcagcctat
gccaaagaggcggggtttgacggcgtcgagatccatggggcaaacgggtacctgctggac
cagttcctgcgggacggttcaaaccatcgtaccgaccggtacgggggaagccttgcaaac
cgggcacgtcttcccatagagataacagaagcggtagttgcggtctggggtgcaaaaaag
gtaggctaccggatctcgccgcacttcaacctccatgcaatgtcggacacgcacccccgg
gaaactttcgggcacctggcagaccggctcagtaaactcggcatcgcgtacattcacctt
gttgaaccggtcggcggcaaactgggggaggtaagcccggatgcgcagatggccccgctc
atccgcaagaaattcgacggggccctgatcctgaacggggggtacgacaaagagagcgca
acccgggtaattgaagacggccttgcagaccttgtggcatttggcaccctgttccttgca
aacccggatcttcccgagcgtttcaagagaggtgcaccgctgaacacggaagacccggca
acgttctataccggtgaggaaaaggggtacacggattaccctgcactgggaaagtaa

DBGET integrated database retrieval system