KEGG   Methanoregula boonei: Mboo_1550Help
Entry
Mboo_1550         CDS       T00578                                 

Definition
(GenBank) hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABS56067
JGI: mboo1550
UniProt: A7I8K6
Position
complement(1620098..1620430)
Genome map
AA seq 110 aa AA seqDB search
MDGQEIPKQAKTGFYSGTLSPEWLIRVVFIIPNADFSILIPVKSVPRLNNIGVFYPEKNP
GPADMGLMNHHRNAKAGRERGVKSPRAPMITCERRKPKAGMWSLWAKNEI
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtggacgggcaggagatcccaaaacaggcaaaaacaggtttttactcaggaactctttca
ccggagtggctcatcagggtggtgtttattatcccgaatgctgatttcagtatattaatt
cctgtgaaaagtgtaccccggttaaacaacatcggggttttttaccctgaaaaaaatccg
ggtcccgccgatatgggtctcatgaatcatcacaggaacgcaaaagccggccgggaaagg
ggtgtaaaatctccccgggcaccaatgataacctgtgagagaagaaaaccaaaagcaggc
atgtggtccttatgggcgaagaacgagatctga

DBGET integrated database retrieval system