KEGG   Methanoregula boonei: Mboo_1567Help
Entry
Mboo_1567         CDS       T00578                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_6 HTH_7 Sigma70_r4 Glyco_hydro_114
Motif
Other DBs
NCBI-ProteinID: ABS56084
JGI: mboo1567
UniProt: A7I8M3
Position
complement(1635694..1636302)
Genome map
AA seq 202 aa AA seqDB search
MPRVVPEYKEDAKRRIIAAAIDVIAQRGCEGMTVDDVAKKIGVTKGAVYWYFPSKEELMT
AVLDSLQAEIRQVTYESFYNRPAEDLLMQIFDRFAVVDPKKRVVFFDMLTLANRNSQVRH
AIREYYDGLVATFESAVTREKKKKFIQTQADPHHLALMLAALYSGLQNYDMLMMHQDELR
ELWREGVRILLKSSYSGTYGEK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcccagggtcgtcccggagtacaaggaagatgcaaagcgccggatcattgctgcggca
atcgatgtgatcgcacaacgcggctgcgaaggtatgactgttgacgatgtggcaaaaaag
atcggtgtgaccaagggcgcggtctactggtatttcccaagcaaggaagaactcatgacc
gcggtgctcgactcgctccaggcagagatcagacaggtcacgtacgaatccttctacaac
cggcctgccgaagacctgctcatgcagatcttcgaccgttttgctgttgtcgacccaaag
aagcgggtggtgttttttgatatgctcaccctcgcaaaccggaactcgcaggtgcggcat
gccattcgggaatattacgacgggcttgtcgcgaccttcgagagtgcagtcacccgggaa
aagaagaaaaaattcatccagacgcaggcagatccacaccacctcgccctgatgcttgct
gccctctactccgggctccagaactacgacatgctcatgatgcatcaggacgaactcagg
gagctctggagggaaggggtcaggatcctgctaaagtcctcgtattcgggaacgtacggt
gagaaatga

DBGET integrated database retrieval system