KEGG   Methanoregula boonei: Mboo_1573Help
Entry
Mboo_1573         CDS       T00578                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mbn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mbn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mbn00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mbn00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mbn00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1642015..1642704
Genome map
AA seq 229 aa AA seqDB search
MHEEHFHMTAPLILVNLKTYKEGMGNRAHQIATAAQLVARESGAVIGIAPGYIDLHPICH
HFAIPVYAQHVDGYEPGARTGHMPVEAIKLAGAAGSLVNHSERRLTLAEIELAVRGIQTQ
KLSSVVCTNNDITSAAAAALGPDYVAIEPPELIGSGVSVAKANPEIIRRSVAAVRAINPK
VKILTGAGIQSGECVKIAIDLGTDGVLLASSVVKAPDPVVILRDLVSKL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggagcatttccacatgacagcgcccctgatcctggtaaatctcaagacatac
aaggaaggcatgggcaaccgcgcccaccagatcgccactgccgcacagctggtagcaagg
gagagcggggccgtgatcggcattgccccggggtatattgacctccacccaatctgccac
cattttgcgatcccggtgtatgcccagcacgtggacgggtacgaacccggggcacggacc
ggacatatgccggtcgaagcgataaaactggccggggccgcggggtcgcttgtcaaccat
tccgaacggaggctcacccttgccgagatcgagcttgcggtccgggggatccagacccag
aagctttccagtgtggtctgcaccaacaacgatatcacaagcgccgcggcagcagcgctt
ggcccggactatgtcgcaatcgagccgccggagctcatcgggagcggggtctcggtcgca
aaggcaaaccccgagatcatccggcgctcggttgccgctgtccgtgcgataaacccgaag
gtaaagatccttaccggcgccgggatccagagtggcgaatgcgtgaagattgcgattgat
ctcgggacagacggcgtactccttgcctcaagcgtggtaaaagccccggatccggttgtg
atactccgcgaccttgtctctaaactctaa

DBGET integrated database retrieval system