KEGG   Methanoregula boonei: Mboo_1573Help
Entry
Mboo_1573         CDS       T00578                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_1573
   01230 Biosynthesis of amino acids
    Mboo_1573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1573
   00051 Fructose and mannose metabolism
    Mboo_1573
   00562 Inositol phosphate metabolism
    Mboo_1573
Enzymes [BR:mbn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mboo_1573
Exosome [BR:mbn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mboo_1573
  Exosomal proteins of bladder cancer cells
   Mboo_1573
  Exosomal proteins of melanoma cells
   Mboo_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1642015..1642704
Genome map
AA seq 229 aa AA seqDB search
MHEEHFHMTAPLILVNLKTYKEGMGNRAHQIATAAQLVARESGAVIGIAPGYIDLHPICH
HFAIPVYAQHVDGYEPGARTGHMPVEAIKLAGAAGSLVNHSERRLTLAEIELAVRGIQTQ
KLSSVVCTNNDITSAAAAALGPDYVAIEPPELIGSGVSVAKANPEIIRRSVAAVRAINPK
VKILTGAGIQSGECVKIAIDLGTDGVLLASSVVKAPDPVVILRDLVSKL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggagcatttccacatgacagcgcccctgatcctggtaaatctcaagacatac
aaggaaggcatgggcaaccgcgcccaccagatcgccactgccgcacagctggtagcaagg
gagagcggggccgtgatcggcattgccccggggtatattgacctccacccaatctgccac
cattttgcgatcccggtgtatgcccagcacgtggacgggtacgaacccggggcacggacc
ggacatatgccggtcgaagcgataaaactggccggggccgcggggtcgcttgtcaaccat
tccgaacggaggctcacccttgccgagatcgagcttgcggtccgggggatccagacccag
aagctttccagtgtggtctgcaccaacaacgatatcacaagcgccgcggcagcagcgctt
ggcccggactatgtcgcaatcgagccgccggagctcatcgggagcggggtctcggtcgca
aaggcaaaccccgagatcatccggcgctcggttgccgctgtccgtgcgataaacccgaag
gtaaagatccttaccggcgccgggatccagagtggcgaatgcgtgaagattgcgattgat
ctcgggacagacggcgtactccttgcctcaagcgtggtaaaagccccggatccggttgtg
atactccgcgaccttgtctctaaactctaa

DBGET integrated database retrieval system