KEGG   Methanoregula boonei: Mboo_1573Help
Entry
Mboo_1573         CDS       T00578                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbn  Methanoregula boonei
Pathway
mbn00010  Glycolysis / Gluconeogenesis
mbn00051  Fructose and mannose metabolism
mbn00562  Inositol phosphate metabolism
mbn01100  Metabolic pathways
mbn01110  Biosynthesis of secondary metabolites
mbn01120  Microbial metabolism in diverse environments
mbn01130  Biosynthesis of antibiotics
mbn01200  Carbon metabolism
mbn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1573
   00051 Fructose and mannose metabolism
    Mboo_1573
   00562 Inositol phosphate metabolism
    Mboo_1573
Enzymes [BR:mbn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mboo_1573
Exosome [BR:mbn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mboo_1573
  Exosomal proteins of bladder cancer cells
   Mboo_1573
  Exosomal proteins of melanoma cells
   Mboo_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABS56090
JGI: mboo1573
UniProt: A7I8M9
Position
1642015..1642704
Genome map
AA seq 229 aa AA seqDB search
MHEEHFHMTAPLILVNLKTYKEGMGNRAHQIATAAQLVARESGAVIGIAPGYIDLHPICH
HFAIPVYAQHVDGYEPGARTGHMPVEAIKLAGAAGSLVNHSERRLTLAEIELAVRGIQTQ
KLSSVVCTNNDITSAAAAALGPDYVAIEPPELIGSGVSVAKANPEIIRRSVAAVRAINPK
VKILTGAGIQSGECVKIAIDLGTDGVLLASSVVKAPDPVVILRDLVSKL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggagcatttccacatgacagcgcccctgatcctggtaaatctcaagacatac
aaggaaggcatgggcaaccgcgcccaccagatcgccactgccgcacagctggtagcaagg
gagagcggggccgtgatcggcattgccccggggtatattgacctccacccaatctgccac
cattttgcgatcccggtgtatgcccagcacgtggacgggtacgaacccggggcacggacc
ggacatatgccggtcgaagcgataaaactggccggggccgcggggtcgcttgtcaaccat
tccgaacggaggctcacccttgccgagatcgagcttgcggtccgggggatccagacccag
aagctttccagtgtggtctgcaccaacaacgatatcacaagcgccgcggcagcagcgctt
ggcccggactatgtcgcaatcgagccgccggagctcatcgggagcggggtctcggtcgca
aaggcaaaccccgagatcatccggcgctcggttgccgctgtccgtgcgataaacccgaag
gtaaagatccttaccggcgccgggatccagagtggcgaatgcgtgaagattgcgattgat
ctcgggacagacggcgtactccttgcctcaagcgtggtaaaagccccggatccggttgtg
atactccgcgaccttgtctctaaactctaa

DBGET integrated database retrieval system