KEGG   Methanoregula boonei: Mboo_1573Help
Entry
Mboo_1573         CDS       T00578                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_1573
   01230 Biosynthesis of amino acids
    Mboo_1573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1573
   00051 Fructose and mannose metabolism
    Mboo_1573
   00562 Inositol phosphate metabolism
    Mboo_1573
Enzymes [BR:mbn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mboo_1573
Exosome [BR:mbn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mboo_1573
  Exosomal proteins of bladder cancer cells
   Mboo_1573
  Exosomal proteins of melanoma cells
   Mboo_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1642015..1642704
Genome map
AA seq 229 aa AA seqDB search
MHEEHFHMTAPLILVNLKTYKEGMGNRAHQIATAAQLVARESGAVIGIAPGYIDLHPICH
HFAIPVYAQHVDGYEPGARTGHMPVEAIKLAGAAGSLVNHSERRLTLAEIELAVRGIQTQ
KLSSVVCTNNDITSAAAAALGPDYVAIEPPELIGSGVSVAKANPEIIRRSVAAVRAINPK
VKILTGAGIQSGECVKIAIDLGTDGVLLASSVVKAPDPVVILRDLVSKL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggagcatttccacatgacagcgcccctgatcctggtaaatctcaagacatac
aaggaaggcatgggcaaccgcgcccaccagatcgccactgccgcacagctggtagcaagg
gagagcggggccgtgatcggcattgccccggggtatattgacctccacccaatctgccac
cattttgcgatcccggtgtatgcccagcacgtggacgggtacgaacccggggcacggacc
ggacatatgccggtcgaagcgataaaactggccggggccgcggggtcgcttgtcaaccat
tccgaacggaggctcacccttgccgagatcgagcttgcggtccgggggatccagacccag
aagctttccagtgtggtctgcaccaacaacgatatcacaagcgccgcggcagcagcgctt
ggcccggactatgtcgcaatcgagccgccggagctcatcgggagcggggtctcggtcgca
aaggcaaaccccgagatcatccggcgctcggttgccgctgtccgtgcgataaacccgaag
gtaaagatccttaccggcgccgggatccagagtggcgaatgcgtgaagattgcgattgat
ctcgggacagacggcgtactccttgcctcaagcgtggtaaaagccccggatccggttgtg
atactccgcgaccttgtctctaaactctaa

DBGET integrated database retrieval system