KEGG   Methanoregula boonei: Mboo_1581Help
Entry
Mboo_1581         CDS       T00578                                 

Definition
(GenBank) Protein-glutamate O-methyltransferase
  KO
K00575  
chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
mbn  Methanoregula boonei
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mboo_1581
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mboo_1581
Enzymes [BR:mbn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mboo_1581
Bacterial motility proteins [BR:mbn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mboo_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1652328..1653137
Genome map
AA seq 269 aa AA seqDB search
MTLEKDDGFSALKRYIEQTLKIQCSNYKEDYIKRRLLSRMRSTGTSAYDEYLRYLREHEP
ELENLRNALTINVTEFFRDADVYNLIKKEVFPALFKGRKTIRIWCAGCSTGEEPYSLAMM
LSDMMAADKTISGQIFATDIDEVVLKKAKEGIYPEKSMGKLSETQVHRHFTKLPDGNFQV
KPHLQSLIRFRPHDLMSGQPISRYLDMISCRNVTIYFTEKQKDELAKMFHAALVPGGYYV
MGKTEYLGREVEGLFSPVNSIQKIYTRKD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagagaaagacgacggtttttccgccctgaagcggtatatcgagcagacgtta
aagatccagtgttccaactacaaggaggactacatcaagcgccggctcctctcacgcatg
cggtccaccggcacctcggcatatgacgaatatctccggtacctgcgcgagcacgaaccg
gagctcgaaaacttgagaaacgcactcacgataaacgttacagagttcttccgcgatgcc
gacgtgtataatcttatcaaaaaggaggtattccccgcactcttcaaaggcaggaagaca
atcaggatttggtgcgccggctgctcgaccggcgaagagccgtattcccttgccatgatg
ctctcggatatgatggctgctgacaagaccatctccggccagatctttgccaccgatatc
gatgaggtggtgctcaagaaggcaaaagaggggatttatccggagaaatccatgggtaaa
ctctctgagacccaggttcaccgccatttcacgaagcttcccgacggtaatttccaggta
aaaccgcatctccagtcgctcatccggttccgcccccacgatcttatgagcggccagccg
atctcgcgctacctggacatgatcagctgccggaacgtgaccatctactttaccgagaag
cagaaagatgaactggcaaaaatgttccatgcagcgctcgtgcccggcgggtactacgtg
atgggcaagaccgaatatctcgggcgagaggtagaagggctcttttcgccggtcaattcc
atccagaaaatttacacaagaaaagactag

DBGET integrated database retrieval system