KEGG   Methanoregula boonei: Mboo_1582Help
Entry
Mboo_1582         CDS       T00578                                 

Definition
(GenBank) hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMEM220 Wzy_C Sarcoglycan_1 YfhO FA_desaturase DUF5313 DUF4131 Phage_holin_3_6 Zn_peptidase_2 YajC DUF4133 DUF2207 Ndc1_Nup
Motif
Other DBs
NCBI-ProteinID: ABS56099
JGI: mboo1582
UniProt: A7I8N8
Position
complement(1653146..1653487)
Genome map
AA seq 113 aa AA seqDB search
MAQKGPVLRGYRLFRKRFSTPLVNIDDMDVPGLRTWVIFYLISFVVLLWAAFLTVNGTML
WVSLMLVIVVVGINFVTVYNQIKSQASRKAMQAELTKNIGKEDKKEVDDRQRH
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaagggccccgtcctccgcggctaccggctttttcggaaacggtttagtact
cctttggtaaatattgatgatatggatgttcccggcctgaggacatgggtgatcttttac
ctgatctcgtttgtcgttcttctctgggccgcgtttctgactgtaaacggcaccatgctc
tgggtgagcctgatgcttgtgatcgtggtcgtgggcatcaactttgtcaccgtgtacaac
cagataaagtcccaggcctcgcgcaaggccatgcaggctgaactgaccaaaaatattggc
aaggaagacaaaaaagaggtcgacgaccgccagcgccactaa

DBGET integrated database retrieval system