KEGG   Methanoregula boonei: Mboo_1592Help
Entry
Mboo_1592         CDS       T00578                                 

Definition
(GenBank) Xylose isomerase domain protein TIM barrel
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1661482..1662255)
Genome map
AA seq 257 aa AA seqDB search
MTVRPYFSSSAKVWDDISWVYGIEEAGYPGWEIVADGNYRFEQPENLKKIKEVLASTGLK
ATVHAPYGDLNLATLNDPIWRESIRQVEVCIAGAGELTDRVTIHPGYLSPAGKLLPGKVW
DLQKEALRRIGKCAVEHGVLACLENMISHKEFLCRDVGELMGMAGGIEGIGLTFDFGHAN
TVGKVPEFLAQVGSANHIHIHDNHGVLDEHLMLGAGTIDWKSVGKGVAARYNGVAAIEGR
SVEEAKKSLAVFKEYFV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccgcccgtatttctcctcatcggctaaagtctgggacgatatctcctgggta
tacggcattgaggaagccgggtatcccggctgggagatcgtggcggatggcaattaccgg
ttcgagcagcccgagaacctcaaaaaaatcaaagaggtgcttgcaagtaccggccttaag
gccacggtgcatgcaccttacggcgatctcaatcttgcgaccctcaatgacccgatctgg
cgcgagtctatccggcaagtagaggtctgcatcgcgggtgccggggagctcaccgaccgg
gtcacgatccaccccggctatctctccccggcaggaaaactcctgcccggcaaggtctgg
gatctccagaaagaggccctgcgccggatcgggaagtgcgccgtagagcacggggtgctt
gcctgcctggagaatatgatcagccacaaggaatttctctgccgtgacgtgggagaactc
atggggatggccggcgggatcgagggcatcggactcacgtttgatttcgggcacgcaaac
accgtgggcaaggtccccgagttccttgcacaggtcggttctgcaaaccacatccacatc
catgacaaccacggcgttcttgacgagcacctgatgctcggcgccgggacgatcgactgg
aagagcgtgggaaaaggcgttgccgcacgttacaatggggtggccgcgatcgagggccgc
tcggttgaggaggcaaaaaagagccttgcagtctttaaggagtattttgtatga

DBGET integrated database retrieval system