KEGG   Methanoregula boonei: Mboo_1594Help
Entry
Mboo_1594         CDS       T00578                                 

Definition
(GenBank) Radical SAM domain protein
  KO
K04069  pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
mbn  Methanoregula boonei
Brite
Enzymes [BR:mbn01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     Mboo_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-ProteinID: ABS56111
JGI: mboo1594
UniProt: A7I8Q0
Position
complement(1662797..1663609)
Genome map
AA seq 270 aa AA seqDB search
MIRYGDGIRLNYGGFIPLSTVDWRGRSVCTVFFRGCPLRCSYCQNAAILAGEDLRDTDEI
IDLIQGSKIAASGVVFSGGEPTMQKDALLVLARAAKKFGLAVGIQTNGLFPDTIDVLIRE
RLVDRIAIDYKTQWEGFTCAGEGAGLTSPNYKKNVQRSVEIAAAAFREKILPEFEIVVTV
FYENAKYLQEISRMFGDIPLVLQQGEHKIPMVPGGVRNASAYLAEKQAGLGQYTPLTLAE
IKTIADGLKRDVRIRTREIGEMAYNRRYLL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgattcgttacggtgatggtatcaggctgaactatggtggttttatcccgctctcgacc
gtggactggcggggccggtcggtctgtaccgtctttttccggggctgcccgctccggtgc
tcgtactgccagaacgcggcgatcctggccggtgaggacctgcgggatactgacgagatt
atcgatctgattcagggatcgaagattgcagccagcggcgtggtcttttccgggggcgag
cccacgatgcagaaggatgcgcttctcgttcttgcccgtgcggcaaaaaagtttggcctt
gccgtgggaatccagacaaacggcctcttcccggatacgatagatgtgctcatccgcgaa
cggctggtggaccggatcgcgatcgattacaagacgcagtgggagggtttcacctgtgcc
ggggaaggtgcaggactcaccagcccgaattacaaaaagaacgtgcagcggtcagtggag
atcgcggccgctgcattccgggaaaagatccttcctgagttcgagatcgtagtaaccgta
ttttatgagaatgcgaaatacttacaggagatttcacgcatgtttggcgacatcccgctc
gtcctccagcagggggagcacaagatccccatggtcccgggcggggtaagaaacgcctct
gcctaccttgcagaaaagcaggccggcctcgggcagtacacgcctttaacacttgccgag
atcaaaacaattgccgacgggctcaaacgggatgtaaggatccggacccgggagatcggc
gagatggcatataaccggaggtatctcctgtga

DBGET integrated database retrieval system