KEGG   Methanoregula boonei: Mboo_1596Help
Entry
Mboo_1596         CDS       T00578                                 

Definition
(GenBank) AAA family ATPase, CDC48 subfamily
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
mbn  Methanoregula boonei
Brite
Messenger RNA biogenesis [BR:mbn03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     Mboo_1596
Membrane trafficking [BR:mbn04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Mboo_1596
Exosome [BR:mbn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mboo_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA CDC48_N AAA_2 RuvB_N CDC48_2 AAA_16 TIP49 AAA_33 AAA_22 AAA_5 AAA_14 RNA_helicase AAA_18 Mg_chelatase IstB_IS21 AAA_28 AAA_24 AAA_3 Parvo_NS1 TsaE Sigma54_activat PhoH Bac_DnaA Vps4_C DUF2075 NACHT
Motif
Other DBs
NCBI-ProteinID: ABS56113
JGI: mboo1596
UniProt: A7I8Q2
Position
1665165..1667570
Genome map
AA seq 801 aa AA seqDB search
MAESDFFEVTVKEAAHNDASRGIARLSVDVMKKLNLVSGDVIEIVGKKNAAAIVWPGFAE
DIGFAILRIDGSIRANANAGIDEKVKIRKSEAVYATKVVIQPTQATQLVGGEQYLSRVLR
GRSVVEGQTLRVDIIGNSVTFVIVRVSPRAIAIVSDDTEIELKNEPFNPEEGKREISSIQ
YEDIGGLERELQLVREMIELPLRHPELFEKLGIKPPKGVLFYGPPGTGKTLIAKAVANEV
DAHFSTLSGPEIMSKFYGDSEKALRDKFHDAEENAPSIIFIDEIDAIAPKREDVQGEVER
RIVAQLLALMDGLAGRGQVVVIAATNLPNSIDPALRRGGRFDREIEIGIPDKKGRLEIFQ
VHTRGVPLAKDVDIAALAETTFGFVGADIALLVKEAAMNAIRKIIPLIDINKQIPAEVIE
QLRITKNDFDTARKIVQPSALREVLIEIPDVAWEDIAGLDQTKDTLIKIIEGRLRYPKIF
EKLDYKPPRGILLFGPPGTGKTLLAKGIASKRQLNFISVKGPELLSKGVGDSEKHVREAF
RKARQSAPCIIFFDEIDALFPKRGTVADNTHVTESVLSQFLTELDGIEELKEVFVIGATN
RPDLLDPALLRPGRLEKHLYIPPPDEAARKAILATYLRGIEGVLDPDVNTGELAAQTRFF
VGADLEALVREAKAIVIDEVTGDGSTGEEKIPETVRITRQHFDAALEQVKGTLDGTDFER
YEQKSWDLLYAKNRREILYQAVGLINQVEYLRGKTTLKAGIIKQADELRDLVYWQRRSFD
EIRERTEKLRKALEACTKSPD
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatctgattttttcgaggtaacggtcaaagaggcggcgcacaacgatgcaagc
cggggtattgcccggctcagtgtcgatgtgatgaaaaaactcaaccttgtctcgggcgat
gtcatcgagatcgtgggaaagaagaacgctgcggcgattgtctggccgggctttgccgag
gacatcggctttgcgatcctccggatagacgggagcatacgggcaaacgcgaatgccggc
attgacgagaaggtgaagatccgcaaatccgaggcggtgtacgcgacaaaagtcgtgatc
cagccgacccaggccacccagctcgtgggcggggagcagtacctttcaagggtgctccgg
ggtcgctcggtggtagagggccagacgctccgcgtcgatatcatcgggaactccgtcacg
ttcgtgattgtccgggtctccccccgggccatcgcgattgtctccgatgacaccgagatc
gagctcaagaacgagccgttcaatcccgaagaaggaaagcgggagatctcctccatccag
tacgaggacatcggcggcctcgaacgcgagctccagctggtgcgcgagatgatcgaactc
cccctgcgccaccctgagctctttgaaaaactggggataaagcccccgaagggtgtcctc
ttctacggcccgccgggcacaggtaagaccctgattgcaaaggctgtggcaaacgaggta
gatgcccacttcagcacgctctcgggccccgagatcatgagcaagttctacggggacagc
gaaaaagccctgcgggacaagttccacgacgcggaggagaacgccccgtccatcatcttt
attgatgagatcgacgcgatcgcccccaagcgcgaggacgtgcagggagaggtggagcgc
cggatcgtggcacagctcctggccctcatggacggccttgccgggcggggacaggtcgta
gtgattgcggcaacaaacctccccaactccattgacccggcgctccggcgtggagggagg
tttgaccgcgagatcgagatcggcattccggacaagaagggacgtttagagatcttccag
gtgcacacccggggcgtgccgctggcaaaggacgtggatatcgccgcccttgccgagacc
acgtttgggtttgtgggcgccgatatcgcgcttctggtcaaggaagccgcgatgaacgcg
atccggaagatcatcccgctcatcgacatcaacaagcagatcccggccgaggtgattgag
cagctgcggatcacaaaaaacgatttcgatacggcccggaagattgtccagccaagcgcc
ctgcgcgaggtgcttatcgagatcccggatgtggcatgggaggatattgccgggcttgac
cagaccaaggatacgctgattaagatcatcgaggggcgcctgcggtacccgaagatcttc
gagaaactggactacaagcccccccgggggatcctcctctttggtccgcccgggaccggg
aaaacgctgcttgcaaagggcatcgcaagcaagcgccagctcaacttcatctcggtcaag
ggccccgagctcctctccaaaggggtgggagattccgagaagcatgtgagggaggcgttt
cgcaaggcccgccagtcggcgccctgtatcatcttctttgacgagatcgacgcgctcttc
ccgaaaagaggcacggttgccgacaacacgcacgtgaccgagagcgtgctctcccagttt
ttgaccgagctcgacggcatcgaggaactcaaggaggtctttgtgatcggggccaccaac
cgccccgacctgcttgacccggccctgctccgtcccggccggctcgaaaaacacctgtac
attcccccgccggatgaggcggcacgaaaagcgatccttgccacctatctccggggcatt
gagggagtccttgacccggacgtgaacaccggtgaacttgccgcacagacccggtttttt
gtgggcgctgatctcgaagcgctggtaagagaggcaaaggcgatcgtgatcgatgaggtg
accggggatggcagcaccggggaggagaagataccggagacggtccggatcacccggcag
catttcgatgctgcgctggaacaggtcaagggcacacttgacggaacggacttcgaacgg
tacgagcagaagtcctgggacctcctgtacgcgaaaaacaggcgcgagatcctgtaccag
gcagtcggtctcatcaaccaggtcgagtacctcagggggaaaaccacgcttaaagccggg
atcataaaacaggccgacgaactgcgggatctcgtgtactggcagcggcgttcgtttgac
gagatccgggaacgtaccgaaaagctccggaaggcgcttgaagcatgtaccaaatctccg
gattaa

DBGET integrated database retrieval system