KEGG   Methanoregula boonei: Mboo_1599Help
Entry
Mboo_1599         CDS       T00578                                 

Definition
(GenBank) hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1670737..1670925
Genome map
AA seq 62 aa AA seqDB search
MSKMVMVAVWILIGLLLIIAGVTSMMTLYITGICLILAGLLIIIVAIKKALWKKPEMMAP
AK
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatggtaatggtcgcagtgtggattttgatcgggcttctcctgattattgcc
ggagtcacaagtatgatgacgctctatataacaggtatctgcctgatccttgcaggactt
ttgatcatcatcgtggcaatcaagaaggcgctctggaagaaaccggaaatgatggcgccg
gcaaaataa

DBGET integrated database retrieval system