KEGG   Methanoregula boonei: Mboo_1606Help
Entry
Mboo_1606         CDS       T00578                                 

Definition
(GenBank) chaperone protein DnaK
  KO
K04043  molecular chaperone DnaK
Organism
mbn  Methanoregula boonei
Pathway
mbn03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mboo_1606
Messenger RNA biogenesis [BR:mbn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     Mboo_1606
Chaperones and folding catalysts [BR:mbn03110]
 Heat shock proteins
  HSP70 / DNAK
   Mboo_1606
Mitochondrial biogenesis [BR:mbn03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    Mboo_1606
  Matrix
   MMC/PAM proteins
    Mboo_1606
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Mboo_1606
Exosome [BR:mbn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mboo_1606
  Exosomal proteins of breast cancer cells
   Mboo_1606
  Exosomal proteins of colorectal cancer cells
   Mboo_1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA FtsA
Motif
Other DBs
NCBI-ProteinID: ABS56123
JGI: mboo1606
UniProt: A7I8R2
Position
1679623..1681512
Genome map
AA seq 629 aa AA seqDB search
MAKEKIIGIDLGTSNSEAAVMVGGKPTIVPSAEGATVAGKMFPSYVAFTPDGQLLVGEPA
RRQAVSNPEGTVTAAKRKMGTNHVYKIYGKEYTPQQISAFILQKIKRDAEAFLGEKITKA
VITVPAYFNDNQRTATKDAGKIAGLDVVRLVNEPTAASMAYGLDKGGEFKILVFDLGGGT
LDVTIMEFGGGTFTVLATSGDTQLGGTDMDNAIFEWIADEFKKQEGIDLRADKMAVNRVR
EAAEKAKIELSTVMETEINLPYVSATQTGPKHLNIKLSRSKLEQLIDPIIRRCIKPFEQA
LKDAKLTKDDVQKVILVGGPTRMPVVQKFIEDHVGKKMERGIDPMECVAMGAAIQGGILG
GEINDMVLLDVTPLTLGLETLGGVRTALIDRNTTIPTKKSQIFSTAADMQTEVTIHVLQG
ERPMAADNVSLGQFNLVGLPPAPRGVPQVEVTFDIDASGILNVSAKDLGTGKVQKMTITA
STKLGETDVRKMVDEAKQFEEQDRQRKEEVEARNIADSLVYTAEKTKTDLADKLNPDMVE
RLNAAITGVKAALEGKDTASVKTETEKLQKVLSEAGSAAYQAAARQQAEQQGASQNTQQP
SQDAGGSGNAGGPGGENVVDADFKVKDEK
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaaatcatcggaattgaccttggtacctcaaacagcgaagctgccgtc
atggtcggcggtaaaccgactattgtcccgtccgcagagggggctacagttgccgggaaa
atgtttccctcctatgtggcctttaccccggatggccagcttctcgtaggggaaccggca
cggcggcaggccgtaagcaaccccgagggtaccgttaccgcagcaaagagaaagatgggg
acaaaccacgtctataagatctacgggaaggagtacaccccccagcagatctcggcgttc
atcctccagaagatcaaacgcgatgccgaagcgttcctgggagagaagatcacaaaggcc
gtcatcactgtccctgcctacttcaacgacaaccagcggaccgcaacaaaggatgccgga
aagatcgccggcctcgacgtagtcaggctggtgaacgaacccaccgcagcatccatggca
tacggccttgataagggtggcgagttcaagatcctggtctttgatctcggcggcggcacg
ctcgatgtcaccattatggagttcggcggcggcacgtttaccgttcttgcaacctccggg
gacacccagctgggcggcacggacatggacaatgccatcttcgaatggatcgcagatgag
ttcaaaaaacaggaaggcatcgatctcagggcagataagatggcagtcaaccgggtcagg
gaggctgccgaaaaggccaagattgaactttccaccgttatggaaacggagatcaacctt
ccctatgtatcggcgacccagaccggccccaagcacctcaacatcaagctctcgcggtca
aaactcgaacagctgatcgacccgatcataagaaggtgcatcaaacccttcgagcaggcc
ctcaaagatgcaaaactcacaaaagacgatgtccagaaagtgatccttgtcgggggaccg
acccggatgccggttgtccagaaatttatcgaggaccatgtagggaaaaagatggaacgc
ggtattgacccgatggagtgcgtggccatgggtgccgcgatccagggcgggatccttggc
ggcgagatcaatgacatggtgctgctcgatgtaactcccctgacactcggccttgagacc
ctcggcggggtccggactgcgctcatcgaccggaataccacgatcccgacaaagaagagc
cagatattctcgactgcggcggatatgcagaccgaggtcacgatccatgtgctccagggc
gagcgacccatggcagccgataacgtgagcctgggccagttcaaccttgtcggccttccc
ccggcgccccggggtgtcccacaggtcgaggtcaccttcgatatcgatgcatcgggtatc
ctcaatgtctctgcaaaggatctcggcaccgggaaagtgcagaagatgaccatcacggct
tccacaaaactgggagaaacggatgtcaggaagatggttgacgaggcaaaacagtttgaa
gagcaggaccggcagagaaaggaagaggtcgaggccaggaacatcgcggattcccttgtc
tacacggcagagaaaacaaaaaccgatctggcggataaactcaacccggatatggtcgaa
cggctgaatgctgcgatcaccggggtcaaagcggcactggagggtaaggatactgcaagt
gttaagaccgaaacagaaaaactccagaaagtcttaagcgaggcaggttccgctgcatac
caagcggcagcccggcagcaggcggaacagcagggtgcttcacagaacacacagcagcct
tcgcaggatgccggcggttcgggcaatgccggtggccccggcggcgagaacgttgttgac
gccgacttcaaagtaaaggatgaaaaataa

DBGET integrated database retrieval system