KEGG   Methanoregula boonei: Mboo_1607Help
Entry
Mboo_1607         CDS       T00578                                 

Definition
(GenBank) chaperone protein DnaJ
  KO
K03686  molecular chaperone DnaJ
Organism
mbn  Methanoregula boonei
Brite
Chaperones and folding catalysts [BR:mbn03110]
 Heat shock proteins
  HSP40 / DNAJ
   Mboo_1607
Mitochondrial biogenesis [BR:mbn03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    Mboo_1607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Cytochrom_CIII Anti-TRAP RRM_3 Lar_restr_allev
Motif
Other DBs
NCBI-ProteinID: ABS56124
JGI: mboo1607
UniProt: A7I8R3
Position
1681534..1682601
Genome map
AA seq 355 aa AA seqDB search
MATRDYYEILGVKRDASADDLKKAFRHLARKYHPDLNKGSKEAEEKFKEINEAYQVLGDP
AKKAQYDQGGNVEFAPGETAGYRPPSYDDLFRDYGLGDIFNAFSGGPRGMRQRGGADLRY
DIEISIADAFSGTKNTVAVPHDYECGTCHGTGAEPGHVKDCPTCHGTGEIRNPRKVGNRT
MMSIAQCPDCGGTGKIIDKPCSTCKGSGTVQKMRRIEVTIPRGVEDGQFLRIAGEGEPGE
NQGPPGDLYVVVHVKKDEIFERHGADLQTTAAVGLATALLGGEITVPTITGSASLKIPRG
TQSHTLFRLRGQGMPSLSSGNRGDLLVRVIVKIPANLTKKQEELMKEAFVGGPAG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacgcgactattatgagatccttggcgtaaaacgggatgcctcagcggatgat
ctcaaaaaagcattcaggcaccttgcacgaaagtatcacccggacctgaacaagggcagt
aaagaagcggaagaaaaattcaaggagatcaatgaggcataccaggtgctcggcgacccc
gcaaagaaagcccagtacgaccagggaggcaatgtcgagtttgccccaggagaaacggcg
ggataccgtccgcccagttacgacgacctgttccgggactatggccttggggatattttc
aacgcgttctcggggggaccccgggggatgcggcagcggggcggggcggatctccgctat
gatatcgagatatccatcgccgatgctttcagcgggacgaagaataccgttgccgtaccg
catgattacgaatgcggcacctgccatggaacgggtgcagaacccggtcacgtgaaggac
tgtccaacctgccatgggacgggtgagatccggaacccgcggaaagtaggtaaccgcacg
atgatgagcatcgcccagtgcccggactgtggcggaaccggcaaaatcattgacaagccg
tgcagtacctgcaaaggttcgggaactgtgcagaagatgcggcggatcgaagtgacgatc
ccgcggggcgttgaggacgggcagtttttgcgcattgccggggaaggagaacccggggag
aaccagggccctcccggcgatctctatgttgtggttcacgtaaagaaggatgagatcttc
gaacggcacggtgccgacctgcagaccacagcagcggtcggccttgccaccgcgctcctg
ggaggagagatcacggtaccgacgattaccgggagtgcgtccttaaaaattccccgcggt
acgcagagccatacccttttccggctccggggccaggggatgccgtccctcagttccggg
aaccgcggggatctccttgtcagggtgatcgtgaaaatcccggcaaacctgacaaaaaag
caggaggaactgatgaaggaagcgttcgtgggtgggcctgcagggtga

DBGET integrated database retrieval system