KEGG   Methanoregula boonei: Mboo_1612Help
Entry
Mboo_1612         CDS       T00578                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mbn  Methanoregula boonei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mboo_1612
   01230 Biosynthesis of amino acids
    Mboo_1612
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mboo_1612
   00030 Pentose phosphate pathway
    Mboo_1612
   00051 Fructose and mannose metabolism
    Mboo_1612
  Energy metabolism
   00680 Methane metabolism
    Mboo_1612
Enzymes [BR:mbn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mboo_1612
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mboo_1612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1687166..1688263
Genome map
AA seq 365 aa AA seqDB search
MPKTTISVIKADVGSFPGHSRAHPKLLETAAQMLRAERGKLLLDSFVTHCGDDLELVMTH
SHGANSEAVHRLAWNVFAECTKVAKRFKLHGAGQDLLAEAFTGDIRELGPGVAEMEFEER
ESDPVLIFMADKTGPGAWNFYLYKIFADPFNTPGLVLDPALSGGFVFEVHDTVAKRMITF
SCPEESYSLLAYIGSSSRYVIKYVFKRDGTIVASTSTQRLNLTAGKYVGKDDPVMIVRAE
SGFPSMGEVLEPFTVPVLVAGWMRGSHNGPLLPVGLCDANCTRFDGPPRVVCFGFQVANG
ALVGPADIFDDPAFDRVRARCNELADTIRAQGPFEPHRLSAGEMEYTTLPAVEKELENRW
KLLKE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagaccaccatctccgttattaaggcagatgtaggaagtttccccggccattcc
cgcgcccatcccaagctgcttgaaaccgcggcgcagatgctcagggccgagaggggaaaa
ctcctccttgattcctttgtcacccactgcggcgatgatctcgaactggtcatgacccat
tcccatggggccaacagcgaggccgttcaccgccttgcgtggaatgtttttgccgaatgc
acaaaagttgcaaagagattcaagctgcacggtgccggccaggacctccttgccgaagcc
ttcacgggcgatatccgggaactcggcccgggcgtggccgagatggaattcgaggaacgg
gagtccgatcccgtccttatcttcatggcggacaagacagggcccggggcatggaatttt
tacctgtacaagatctttgccgatcccttcaacacccccgggcttgtcctcgacccggcg
ctctccgggggatttgtcttcgaggtgcatgacaccgtggcaaaacggatgatcacgttc
tcctgccccgaggaaagttacagcctgcttgcctatatcgggtcatcatcgcggtacgtg
atcaagtatgtgtttaaacgggatgggacgattgtggcttccacgagcacccagcgcctc
aaccttaccgcaggaaaatacgtgggaaaagatgatcccgttatgatcgtccgggcagag
agcggttttccctctatgggcgaggtgcttgaacccttcacggtcccggtgcttgtggcc
ggctggatgcgcggctcccacaatggcccgctcctgccggtcggactctgcgatgccaac
tgcacccggtttgacggccctccccgggttgtctgcttcgggttccaggtggcaaacggg
gcccttgtcggcccggctgacatattcgatgaccccgcgtttgaccgggtaagggcacgg
tgcaacgaactcgccgatacgatccgggcgcaggggccctttgaaccccaccgcctttct
gccggggagatggagtacaccacgcttcccgcagttgaaaaggagctggaaaaccgctgg
aaactgctcaaagaataa

DBGET integrated database retrieval system