KEGG   Methanoregula boonei: Mboo_1617Help
Entry
Mboo_1617         CDS       T00578                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2769 zf-Paramyx-P MEKHLA
Motif
Other DBs
NCBI-ProteinID: ABS56134
JGI: mboo1617
UniProt: A7I8S3
Position
complement(1691931..1692275)
Genome map
AA seq 114 aa AA seqDB search
MAMSASTTCVMPEDTFTKAMKSMTKMPANQARAKVGELEKICVCSTCPTYTATCASKAGE
SVFCARGTSFKCITADKGGCICTTCPVSKSMGLQYQAFCLMDGEKAQRFDAMLR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtcagcgagcacaacatgcgtaatgccggaagacaccttcacaaaggcaatg
aagtcaatgacgaagatgccggccaaccaggcaagggcaaaggtgggggaactcgaaaag
atatgcgtctgcagcacgtgcccgacctataccgcgacctgtgcaagtaaggccggtgag
agcgttttctgtgcccgggggacgagttttaagtgcatcaccgcggacaagggaggatgt
atctgcacgacctgcccggtgtcaaaatcgatgggcctccagtaccaggcattctgtctt
atggacggggagaaggcgcaacggttcgacgcgatgcttcggtaa

DBGET integrated database retrieval system