KEGG   Methanoregula boonei: Mboo_1620Help
Entry
Mboo_1620         CDS       T00578                                 

Definition
(GenBank) CoA-binding domain protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1694470..1696554)
Genome map
AA seq 694 aa AA seqDB search
MTRTLLSEAQGYALLEKYGIPVPRYAIVQTAAEAEKKAEEIGFPLVAKIVSSDVIHKSDA
GGVITGIASAEEAGEAFRSIMGNVKAAYPEAGIQGVILEEQQKAGLELIVGGKTDPAFGK
VLSVGMGGTLVELLRDISLRLLPASDETVRAMVRSLRGYPLLAGYRGAGPKDEEAFCAII
GALGRMFLEHAEIAEFDINPVILYGKGACAVDARIYVSDLPLPARQDTGDVAPPGNLFRI
GSVAVVGASQNPDKVGYAICRNMLAFPGALYPVNPGSADILGKTAYPSLSAIPDRVDAVV
IAIPAAGVPAIVEEAGKKKIPLAVIVSSGFREIGPAGKVLEDQVLAAARKYGIRVMGPNC
LGFMLPAQGINTTFDPVSPRAGSIAFVSQSGAIITTIVDWSLPEEIGFSAVISVGNQLDL
TFEDFVAWTGSDPATNAIILYVEEIRDGRRFLDVVSRITPTKPVIVIKSGSSEIGQKAAS
SHTGSLAGSAGVYLAAFREAGMIPVRSIREAFQAAELLASEGYPSGTRAVVISNAGGFAV
LSSDYAERFGIDLVHFPDELVRELDAVLPPAWNRANPMDMVGDSHPEQYAKTFDILIRHQ
DLWDIAFVIAVPTAISNPIRVANELIRFSTHTKKMIVGCMIGGDSMKTPQRILRESKIPN
FPDLEDAFRAVGNICRYTCRSADGHPGCRKGSRD
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaccctgctctccgaggcacaaggttacgcactgctggaaaaatatggcatt
ccggtgccccggtacgcgatcgtgcagacggcggcggaagccgaaaaaaaagctgaagag
atcggctttccgcttgtggcaaagatagtctcgtccgacgtgatccataagagcgatgcg
ggcggtgtcattaccggcattgcatctgctgaggaggccggggaagcattccggtccatc
atggggaacgtgaaggcggcatacccggaggccgggatccagggagtcattcttgaggag
cagcaaaaagccggcctcgaactgatcgtcgggggaaagaccgacccggcattcgggaag
gtgctctcggtgggcatgggcggtacgctcgtggaactgctccgggatatctcccttcgt
ctcctcccggcaagcgacgagactgtccgggccatggtccgcagtctccggggttacccg
cttctcgccgggtaccggggcgccggccccaaagacgaggaggcattctgtgcaatcatc
ggggcactggggcgcatgttccttgaacatgcagagatcgcggagttcgatatcaacccg
gtgatcctgtacgggaagggtgcgtgtgcggtcgatgcccggatttacgtgagtgatctg
ccgttaccggcccgtcaggatacaggcgatgtggcgccgccggggaacctgttccggatc
ggatcggttgccgtagtcggcgcatcccagaacccggataaggtagggtacgccatctgc
cggaacatgcttgcattccccggggccctgtacccggtcaaccccggaagcgcggacatc
ctcgggaagacggcgtatccttccctttctgccatcccggaccgcgtcgatgctgtggtc
attgcgattcctgcggcgggagtgccggccattgtcgaggaagcggggaaaaagaagatc
ccgcttgccgtgattgtttcttcaggtttccgcgagatcgggccggcaggaaaggtgctt
gaggaccaggtgcttgccgctgcacggaagtacgggatccgggtgatgggtcccaactgc
ctgggtttcatgctgccagcacagggaattaatactacctttgatccggtctccccccgg
gccggttccatcgcgtttgtctcgcagagcggggcgattattaccacgattgtggactgg
agcctgcccgaggagatcgggttttcggcagtcatatcggtgggaaaccagctcgatctc
acgttcgaggatttcgttgcatggaccggttctgatccggcgacaaacgccatcatcctg
tacgtggaggagatccgggacgggcggcgtttcctcgatgtggtgagccggatcacaccc
acaaaaccggtgatcgtgataaaatccggatcttcggagattgggcagaaggccgcatcg
tcccataccggatcccttgcagggagtgccggggtgtacctggcagcgttccgcgaggcc
gggatgatcccggtccgctcgatccgggaggcgttccaggccgcagaacttcttgcctcc
gaaggctacccttccggtacccgggccgtggtcatctccaatgccggcgggtttgcggtg
ctctcctcggattatgcggaacgtttcgggatcgatcttgtgcatttcccggacgaactg
gtccgggaactggatgcggtccttcccccggcctggaaccgggccaatcccatggacatg
gtgggggattcacatcccgagcagtacgcaaaaacgtttgatatcctgatccggcatcag
gatctctgggatatcgcgtttgtgatcgcggtcccgacagcaatctccaatcccatacgg
gtggcaaacgagctgatccggttctcaacccacacaaaaaagatgatcgtgggctgcatg
attggcggcgattccatgaagacaccgcaacggatcctacgggagtcaaagatccccaat
ttcccggatctcgaagatgcgttccgggccgtgggaaacatctgccggtacacctgccgg
agtgcggatgggcatcccgggtgccggaaaggatcgcgtgactga

DBGET integrated database retrieval system