KEGG   Methanoregula boonei: Mboo_1625Help
Entry
Mboo_1625         CDS       T00578                                 

Definition
(GenBank) protein of unknown function UPF0153
  KO
K06940  
uncharacterized protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1701510..1702007)
Genome map
AA seq 165 aa AA seqDB search
MTEDWLLRAEAICMACGGHCCDEAHPPVSQERYRALIAAGIPAASFERKEGYFRLRTHKD
NTCILMVDHKCTCHAIKPETCRAGPFTFDVVNDTIRIFLKQASICPIVPLLKEQPAAYHQ
QYERAAENIVRLVSGLPKEEIEAINRIEEPETDLVAVIPREHPPV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagactggctgcttcgtgccgaagctatctgtatggcctgcgggggacactgt
tgcgatgaggcacatcccccggtttcgcaggaacggtaccgtgccctgattgctgccggc
atcccggcagcatcgtttgagcggaaggaaggctatttccggctccggacccacaaggac
aatacctgtatcctcatggtggatcacaaatgcacctgccatgcgatcaagcccgagacc
tgccgggccggtccttttaccttcgatgtggtaaacgacaccatccggatctttttaaaa
caggcatccatatgcccgattgtcccgctccttaaggaacaacctgcggcgtaccaccag
cagtacgaacgggcggcagagaatattgtccggcttgtttccggcctccccaaagaagag
atcgaggcgatcaaccggatcgaggaacccgagaccgatctcgtggcggttattccacgg
gaacaccccccggtatga

DBGET integrated database retrieval system