KEGG   Methanoregula boonei: Mboo_1627Help
Entry
Mboo_1627         CDS       T00578                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RLAN
Motif
Other DBs
NCBI-ProteinID: ABS56144
JGI: mboo1627
UniProt: A7I8T3
Position
complement(1702883..1703626)
Genome map
AA seq 247 aa AA seqDB search
MPESGGSILSKTAGTASGALPRPVVKKRAAAHVLHRKDHAMVRDSLAVIQRDSACHVIAE
DYSYKSEAYYTILAREQAGEATRPSSRDVLDAFVVPVCLERAKRAGIPVAEWGISQAYVP
LPAILYGINYFATATDYAVVRDSDQSKDVIKHITNRGKYPFCYQKIDDDAAICTCTAVFG
KTTDRCATIAGYAEKLYGLFSIPLVNMVFVRNGDTCALSSLAPTRYTRLSPGERAFLAAY
RDHQVFL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatccgggggcagcattctttccaaaaccgcgggcacagcatcaggcgcgctt
ccccgcccggtggtaaaaaagcgggcagcggcacatgtcctgcaccggaaggatcacgcc
atggtgcgggactcccttgcggtgatccagcgggacagtgcctgtcatgtaattgccgag
gactactcatacaaatccgaggcttactacaccattcttgcccgcgagcaggcaggcgag
gcaacccgcccctccagccgcgatgttcttgatgcattcgtggtgccggtctgccttgag
cgcgcaaaacgtgccggtatcccggtagcagaatgggggatctcgcaggcgtacgttccc
ctgccggccatcctgtacggcatcaactactttgccacggctaccgattatgcggtggta
cgggacagcgatcagtcaaaggatgtgatcaagcacatcaccaaccggggcaagtacccc
ttctgctaccagaagatcgacgatgatgcagcgatctgcacctgcacggcagtctttggg
aagactacggacaggtgtgcgacaatcgccggctatgcggagaaactctacgggctcttc
tccatcccgcttgtgaacatggtctttgtccggaacggcgacacctgcgctctctcctcg
ctcgcccccacgcggtacacgcgcctctccccgggagagcgggcattccttgcggcgtac
cgcgatcaccaggtgttcctatga

DBGET integrated database retrieval system