KEGG   Methanoregula boonei: Mboo_1630Help
Entry
Mboo_1630         CDS       T00578                                 

Definition
(GenBank) 4Fe-4S ferredoxin, iron-sulfur binding domain protein
Organism
mbn  Methanoregula boonei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_10 Fer4_6 Fer4_9 Fer4_2 Fer4_7 Fer4_17 Fer4_4 Fer4_16 Fer4_8 Fer4_21 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ABS56147
JGI: mboo1630
UniProt: A7I8T6
Position
complement(1705595..1706401)
Genome map
AA seq 268 aa AA seqDB search
MSSLLRRQILRKTGGMDIPLVGFAPAERWNNPLFEPWVPEAFRPASLVPGTKSVIVIGFP
VSLPIVDTAPSIWYHELYHVVNETLDACAYRLATFLTEKGYPSVWVPRDGYGSITVLKEN
PAAFFSHRHAAFCAGLGTFGENNMLLTPQYGPRVRFASILTSAEIPGDPVLEESLCIRCG
RCVSACPVSAVKSGGYPAHLTDKHACACRSEELRDRYLSPCGCCIKVCPVGNDRQQYNRN
DMRMYDDHNPLSEPYRRVRDHVRSYGSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgctcctccggcgccagatcctcaggaaaaccggtggcatggatatcccgctt
gtcggatttgccccggcagagcgctggaacaatcccctgttcgaaccctgggtcccggag
gcattccggccggcatcccttgttcccgggacaaaaagtgtgatcgtgatcggattcccg
gtcagcctcccgatcgtggacactgcaccgtccatctggtaccacgagctgtaccatgtg
gttaacgagactcttgatgcctgtgcgtaccgccttgccacattcctgactgagaaaggt
tacccctcggtctgggtcccccgcgacgggtacgggtcgattacggtcctaaaggagaac
ccggcagctttcttttcccaccggcatgcggctttctgcgcgggtcttggcacattcggg
gagaacaacatgctccttaccccccagtacggcccccgggtcaggtttgcttccattctc
acctcagccgaaatccccggtgacccggttttagaggaatccctctgcatccgttgcggg
cgttgtgtatccgcctgccccgtatcggctgtaaaaagcggcggttacccggcacacctt
accgataagcatgcctgtgcatgccggtcagaagaactccgggaccggtacctgtccccg
tgcgggtgctgcatcaaggtctgccctgtgggaaacgaccggcagcagtacaaccgcaac
gacatgcggatgtacgatgaccacaaccccctctccgaaccctatcgccgcgtccgtgac
catgtccgatcctacgggtcgcggtga

DBGET integrated database retrieval system